Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_101443030.1 BD749_RS03795 ATP-binding cassette domain-containing protein
Query= TCDB::Q9X271 (324 letters) >NCBI__GCF_002846395.1:WP_101443030.1 Length = 259 Score = 109 bits (272), Expect = 8e-29 Identities = 77/236 (32%), Positives = 125/236 (52%), Gaps = 17/236 (7%) Query: 17 VEGIVKAVD------GISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNGRIVDGEAI 70 + G+ KA D G+ L KGE+L ++G SG+GKSV L+++I+ + +G Sbjct: 19 IRGLKKAFDDFEVLKGVDLDLFKGENLVVLGRSGTGKSV----LIKIISGLLQADEGSVN 74 Query: 71 FLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRLMKNEEARE 130 LG+++ L EL +R K I FQN + +R ++ P+I H E RE Sbjct: 75 VLGREVGALKPRELDALRLK-IGFSFQNSALYDSMTVRENLEF--PLIRHAKHMTEAERE 131 Query: 131 RAIE-LLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPTTALDVTI 189 I+ +LE VG+ ++ + P + SGG R+R+ IA L P +++ DEPT LD Sbjct: 132 DTIQYVLEAVGLLQAINQM---PSELSGGQRKRIGIARTLILKPDIMLYDEPTAGLDPIT 188 Query: 190 QAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEILKT 245 +I L+ E++E++ S I ITHDL+ A DRI+ + G+ E +E+ ++ Sbjct: 189 CIEINSLINEVQEKFNTSSIIITHDLTCARAVGDRIVMLLDGQFQREGTFDEVFES 244 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 259 Length adjustment: 26 Effective length of query: 298 Effective length of database: 233 Effective search space: 69434 Effective search space used: 69434 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory