Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_101444884.1 BD749_RS12890 ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_002846395.1:WP_101444884.1 Length = 235 Score = 93.2 bits (230), Expect = 4e-24 Identities = 67/217 (30%), Positives = 113/217 (52%), Gaps = 21/217 (9%) Query: 6 ILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIRL 65 ++ L K YG++ LD G ++++IG NGAGK++M K I G V PD G+I+ Sbjct: 1 MIAIENLSKTYGKLAVLDNLSVRFEGGRVVSIIGPNGAGKTTMSKCILGIVLPDSGDIKF 60 Query: 66 EGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLDRAA 125 +G+ I + A ++ I + Q + I + + R+IRK D Sbjct: 61 KGESILKK---HAYRSQIGYMPQIGKYPENMKIRQVIEMVRDIRK-----------DATV 106 Query: 126 MEKQARAKLSELGLMTIQNI-NQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGV 184 ++++ +GL +QN+ ++ + +LSGG +Q V+ A A F +V+I+DEPTA L Sbjct: 107 IDEEL------IGLYGLQNMYDKRMGSLSGGTKQKVSAALAFMFDPQVLILDEPTAGLDP 160 Query: 185 KESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRI 221 + + IL +++G I++ SH M V EVAD + Sbjct: 161 ISAEILKCKILKEKKKGKLILITSHIMSEVEEVADEV 197 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 235 Length adjustment: 24 Effective length of query: 236 Effective length of database: 211 Effective search space: 49796 Effective search space used: 49796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory