Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_101443438.1 BD749_RS06110 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_002846395.1:WP_101443438.1 Length = 221 Score = 131 bits (330), Expect = 1e-35 Identities = 75/217 (34%), Positives = 120/217 (55%), Gaps = 4/217 (1%) Query: 6 VKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD 65 V NV K K G + L +++ I GE I+G SGAGK+T + I+ LD TG++ FD Sbjct: 4 VVNVHK--KYGSLEVLKGIDLTIHAGEVVSIVGASGAGKSTLLHILGTLDSADTGDVLFD 61 Query: 66 DRLVAS-NGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEV 124 D+ ++ N + +R IG +FQ L P TA EN P + E+ +R E+ Sbjct: 62 DKNISRLNASELARFRNRHIGFIFQFHNLLPEFTAIENACLPGFLAGRPEMEVTERAAEL 121 Query: 125 AKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVK 184 +L++ H ++H P E+SGG+QQR A+ARAL+ P ++ DEP NLD++ + Sbjct: 122 LSMLNLGHRMHHKPSEMSGGEQQRTAVARALINSPRIIFADEPSGNLDSKNAQELHEIFF 181 Query: 185 EVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQ 221 +++ T ++V+H+ + +ADR V+ G +VQ Sbjct: 182 KLRDEFNQTFVIVTHN-EQLATMADRKLVMKDGLIVQ 217 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 221 Length adjustment: 25 Effective length of query: 328 Effective length of database: 196 Effective search space: 64288 Effective search space used: 64288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory