Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_101443868.1 BD749_RS07915 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_002846395.1:WP_101443868.1 Length = 241 Score = 135 bits (340), Expect = 1e-36 Identities = 78/211 (36%), Positives = 126/211 (59%), Gaps = 5/211 (2%) Query: 4 IIVKNVSKVFKKGK--VVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGE 61 I ++SKV++ G + AL +V+I IE GE +GPSG+GK+T M II LD P+ G+ Sbjct: 5 IETNDISKVYRMGSETIHALKSVSIRIERGEYVAFMGPSGSGKSTLMNIIGCLDTPTGGQ 64 Query: 62 LYFDDRLVAS-NGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKR 120 + + V++ + +++IG VFQT+ L P T+ EN+A PL +K ++ Sbjct: 65 YILNGQDVSNMTDNELAEVRNKEIGFVFQTFNLLPRQTSLENVALPLIYAGYNKSAREEK 124 Query: 121 VEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSAR 180 ++ + + + + H P ELSGGQ+QRVA+ARAL+ DPS++L DEP NLD + Sbjct: 125 AQKALESVGLGNRGKHKPNELSGGQRQRVAIARALINDPSIILADEPTGNLDTKTSYEIM 184 Query: 181 ALVKEVQSRLGVTLLVVSHDPADIFAIADRV 211 L + + ++ G T+++V+H+ DI A R+ Sbjct: 185 ELFENLHAK-GNTIIMVTHE-EDIAKYAHRI 213 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 241 Length adjustment: 26 Effective length of query: 327 Effective length of database: 215 Effective search space: 70305 Effective search space used: 70305 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory