Align D-mannitol and D-mannose transporter (MFS superfamily) (characterized)
to candidate WP_101442931.1 BD749_RS03265 sugar MFS transporter
Query= reanno::SB2B:6936374 (413 letters) >NCBI__GCF_002846395.1:WP_101442931.1 Length = 474 Score = 339 bits (870), Expect = 9e-98 Identities = 206/471 (43%), Positives = 269/471 (57%), Gaps = 84/471 (17%) Query: 6 STTPQNGSAAPAQSHQQLL--------FGAMTSLFFIWGFITALNDILIPHLKGIFDLSY 57 S TP A +QS + L +T LFF+WGFIT +NDILIP L+ +F L Sbjct: 3 SITPIKTDEAASQSKETLRDYKNYTSPLIVVTLLFFMWGFITCMNDILIPKLQEVFTLQL 62 Query: 58 TQAMLVQFCFFGAYFLVSPLAGVL-------IARIGYLRGIIFGLSTMATGCLLFYPASS 110 QAML+Q FFGAYF+VS +L I +IGY GII GL A GC+LFYPA+ Sbjct: 63 WQAMLIQTAFFGAYFIVSFFYFMLSITKGDPIQKIGYKNGIIIGLIVAALGCVLFYPAAV 122 Query: 111 LEQYALFLLALFVLASGITILQVSANPFVARLGPERTAASRLNLAQALNSLGHTLGPLFG 170 Y FL+ALF+LASGIT+LQ++ANP+VA LGP T++SR+NL+QALNS G T+ P+ G Sbjct: 123 FHSYGFFLMALFILASGITVLQITANPYVAILGPPETSSSRMNLSQALNSFGTTIAPIIG 182 Query: 171 SLLIFGAAAG----THEAVQLPYLLLAAVIGIIAVGF-------IFLGGKVKHADMGVDH 219 LIF A T ++V+LPYL LAA++ ++A+ + GK++ + V H Sbjct: 183 GYLIFDQVASAEIDTADSVKLPYLGLAALLLLLALLIKVAKLPRLEGSGKIETGAVAVKH 242 Query: 220 RHKGSLLSHKRLLLGALAIFLYVGAEVSIGSFLVNYFAEPSIGGLDEKSAAELVSWYWGG 279 H L+LG + IF+YVG EVSIGS L+NY P I GL E A +++YWGG Sbjct: 243 PH---------LVLGIICIFMYVGGEVSIGSALINYIKLPQITGLTESEAKHYLAFYWGG 293 Query: 280 AMIGRFAGAA------------------------------------------------LT 291 AMIGRF GA L Sbjct: 294 AMIGRFFGAVALSTLKRSGKFMVIALIALVTFLTVYALYDLNEALIILGLIALNVVVLLL 353 Query: 292 RRFNPAMVLAANAVFANLLLMLTIVSSGELALVAVLAVGFFNSIMFPTIFTLAIEGLGEL 351 RF P + A+ LL++ +V+ G LA+ A++A+G FNSIMFPTIF LAI+GLG Sbjct: 354 ARFIPNRTVGLFAMAVIGLLLIGVVAEGTLAMWAIIAIGLFNSIMFPTIFDLAIKGLGRH 413 Query: 352 TSRGSGLLCQAIVGGALLPVIQGVVADNVG-VQLSFIVPTFCYFYICWYAF 401 TS+GS LL AIVGGA++P +QG+ AD G +QLSFI+P CY YI +Y F Sbjct: 414 TSQGSSLLVMAIVGGAIVPPLQGLFADLTGDLQLSFIIPMICYAYIVYYGF 464 Lambda K H 0.329 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 529 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 413 Length of database: 474 Length adjustment: 32 Effective length of query: 381 Effective length of database: 442 Effective search space: 168402 Effective search space used: 168402 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory