Align BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized)
to candidate WP_101444474.1 BD749_RS11520 ABC transporter ATP-binding protein
Query= TCDB::Q93A35 (328 letters) >NCBI__GCF_002846395.1:WP_101444474.1 Length = 611 Score = 122 bits (307), Expect = 2e-32 Identities = 75/229 (32%), Positives = 124/229 (54%), Gaps = 10/229 (4%) Query: 18 AVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTTGTIYINEKRISDYDIHELRW 77 AV+ V+ ++K GE +G SG GKTT + I RL+ T G++ K I+ + LR Sbjct: 355 AVDGVSFEVKHGETIALVGESGSGKTTLGRAILRLVESTAGSVLFEGKDIASMNTKTLRQ 414 Query: 78 DIGYVLQQI------ALFPHMTIEENIAIVPELKKW--SKEKIHDRITELLDSVGLDPES 129 + + Q I +L P T+ E I + K S ++ + EL++ VGL PE Sbjct: 415 NRRH-FQMIFQDPYTSLNPMHTVGEAILEPMRVHKLYGSDKERRGEMLELIEKVGLSPE- 472 Query: 130 YRHRKPAELSGGEQQRVGVVRALAADPGIILMDEPFSALDPISRQRLQQDISALQKKIKK 189 + R P SGG++QR+ + RALA P +++ DE SALD + ++ ++ L++ Sbjct: 473 HAQRYPQAFSGGQRQRIAIARALALQPKLLICDESVSALDVSVQAQVLNLLNELKRDFNM 532 Query: 190 TIVFVTHDMQEALALGDRICVMQGGEIVQVATPQEIMKNPENDFVKDFL 238 T +F+THD+ A + DRI VM G IV+ P ++ +NP++D+ + + Sbjct: 533 TYLFITHDLAVAKHMADRILVMHEGRIVEQGIPVQLFQNPQHDYTRSLI 581 Score = 100 bits (248), Expect = 1e-25 Identities = 71/261 (27%), Positives = 125/261 (47%), Gaps = 16/261 (6%) Query: 18 AVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTT---GTIYINEKRISDYDIHE 74 AV+ V+ + GE +G SG GKT + +L+ G +R+ D+ + Sbjct: 26 AVDKVSFALYPGEAVAIVGESGSGKTVMALSLMQLLDTNAQVGGKAVFQSERLGAVDLLQ 85 Query: 75 LRW---------DIGYVLQQ--IALFPHMTIEENIA-IVPELKKWSKEKIHDRITELLDS 122 L+ ++G + Q +L P T + + ++ +K SK++ +R+ +L + Sbjct: 86 LQEKQLQQLRGNEMGMIFQDPMSSLNPVYTCGQQVVEVLLWHRKISKKEARERVLQLFEQ 145 Query: 123 VGLD-PESYRHRKPAELSGGEQQRVGVVRALAADPGIILMDEPFSALDPISRQRLQQDIS 181 L PE P ++SGG++QRV + A+A +P I++ DE +ALD + R+ I Sbjct: 146 AKLPRPEQIYDSYPHQISGGQKQRVIIAMAMACEPAILIADESTTALDVTVQARMLSLID 205 Query: 182 ALQKKIKKTIVFVTHDMQEALALGDRICVMQGGEIVQVATPQEIMKNPENDFVKDFLASG 241 L+ K ++F++HD+ + DR+ VM G IV+ +I NP++ + K LA Sbjct: 206 ELRVKQNMAVLFISHDLGVVAEIADRVLVMYKGRIVEQGKVLDIFTNPQHPYTKGLLACR 265 Query: 242 HAFNTPILEANFTVNDLIEAD 262 +T TV D +E D Sbjct: 266 PTLSTKSQAKLPTVADFMEED 286 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 328 Length of database: 611 Length adjustment: 32 Effective length of query: 296 Effective length of database: 579 Effective search space: 171384 Effective search space used: 171384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory