Align MFS transporter, FHS family, L-fucose permease (characterized, see rationale)
to candidate WP_101446304.1 BD749_RS16300 sugar MFS transporter
Query= uniprot:A0A1I2JXG1 (442 letters) >NCBI__GCF_002846395.1:WP_101446304.1 Length = 431 Score = 244 bits (622), Expect = 5e-69 Identities = 145/408 (35%), Positives = 227/408 (55%), Gaps = 8/408 (1%) Query: 31 VLTSIFFMWGFLTCLNDILIPHLKAVFKLNYAEAMLVQFTFFGAYFLMSLPAGLLVARLG 90 ++ +FF++GF+T LN ILIP+ K +LN ++ LV F F+ +YF+MS+P+ ++ G Sbjct: 27 IIGVLFFIFGFVTWLNAILIPYFKISLELNNFQSYLVAFAFYISYFVMSIPSAWVLKVTG 86 Query: 91 YKKGIVAGLAVAGVGAAGFWPAAAMHFYPAFLGALFVLATGITVLQVAANAYVALLGPEK 150 +KKG+ GL V GA F PAA FL LFV TG+ +LQ A+N Y+ +LGP + Sbjct: 87 FKKGMSVGLLVMAAGALLFVPAALTRTLELFLIGLFVQGTGLALLQTASNPYITILGPLE 146 Query: 151 SASSRLTLAQALNSLGTFLAPKFGGLLILSAAVLSAEQIAKLSPAEQVAYRVQEAQTVQG 210 SA+ R+++ N +G L G ++LS A ++ +S AE+ A V Sbjct: 147 SAAKRISIMGVSNKIGGILGSIILGAIVLSNADEVVAKLELMSAAEKAVELNAMASKVIM 206 Query: 211 PYLGLAIVLFLLAVFVYLFRLPALTEKTEQASVKQHSL--VSPLRHPHVLFGVLAIFFYV 268 PYL + L LA+ +Y LP + E +V ++ S L+ PH+L G +F YV Sbjct: 207 PYLIITGALVALAIVIYFSSLPEVDTDQEDETVAAANVNKTSILQFPHLLLGAFTMFLYV 266 Query: 269 GGEVAIGSFLVNYLSMPDIGNMSEQAAANWVAYYWLGAM-IGRFIGSALLAK-LSPRKLL 326 G EV G +V+Y + DI + A + + LGAM + F+G A + K + K L Sbjct: 267 GVEVMAGDTIVSYGAAQDISFKT----AKFFTSFTLGAMVVAYFVGVATIPKYIRQDKAL 322 Query: 327 AIFAAINMALVLTTMMTKGTVAMYSVVSIGLFNSIMFPTIFSLGIERMGPMTGEASSLLI 386 I A + + + +MT G V++ + +GL N++M+P IF L I +G T SSL+I Sbjct: 323 QISAILGVVFTVAAIMTSGIVSVTFIALLGLANALMWPAIFPLAIADLGRFTKIGSSLII 382 Query: 387 MAIVGGAIVPFVQGLFADHIGVQHAFFLPLLCYAYIVFYGLYGSRIKS 434 M I GGAI+P + G AD I Q A+++ + CY +I++Y + G +I++ Sbjct: 383 MGIAGGAILPLIYGALADKINPQQAYWIMVPCYLFILYYAMAGHKIRT 430 Lambda K H 0.327 0.140 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 431 Length adjustment: 32 Effective length of query: 410 Effective length of database: 399 Effective search space: 163590 Effective search space used: 163590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory