Align 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 (characterized)
to candidate WP_102106154.1 C0029_RS05155 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= SwissProt::P22256 (426 letters) >NCBI__GCF_002869505.1:WP_102106154.1 Length = 431 Score = 151 bits (382), Expect = 3e-41 Identities = 116/366 (31%), Positives = 177/366 (48%), Gaps = 40/366 (10%) Query: 20 GQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQ 79 G I P+ A R+ +GRE +D G+ HP + AV+ QL+ +SH F Sbjct: 30 GFITPVVG--ANGVRLQLADGRELIDGMASWWCAIHGYNHPVMNRAVQQQLETMSHVMFG 87 Query: 80 VLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGT------IA 133 L + P ++L ++ P + + +GS +VE A+K+A + G +A Sbjct: 88 GLTHPPAIKLAAMLVDLTP-EGLNRVFFSDSGSVSVEVAMKMAIQYWQAIGKPGKQKMVA 146 Query: 134 FSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALY-----------PCPLHGISEDD 182 YHG T T+++ V GM + G V + PCP + E Sbjct: 147 LRSGYHGDTLATMSVCDPVT----GMHHLFGDVVLKQFFAPAPDCAFDGPCPESDMEEIS 202 Query: 183 AIASIHRIFKNDAAPEDIAAIVIEPV-QGEGGFYASSPAFMQRLRALCDEHGIMLIADEV 241 I + H E+IAA+++EPV QG GG SP ++++LRALCD ++LI DE+ Sbjct: 203 DILARHH--------EEIAAVIVEPVVQGAGGMRFYSPDYLRKLRALCDAFDVLLIFDEI 254 Query: 242 QSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGF-PLAGVTGRAEVMDAVAPGGLGG---- 296 +G GRTG LFA+E GV PDL KS+ GG+ LA + + + G G Sbjct: 255 ATGFGRTGKLFALEHAGVEPDLLCLGKSLTGGYMTLAATIANDRIAEGIDGGEAGAFMHG 314 Query: 297 -TYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMI 355 T+ GNP+AC +A+ +++ + + L +L+ G LA A ++ DVR LGA+ Sbjct: 315 PTFMGNPLACASAIASIELLLSQPWQRTVARLQTELEQG-LAPARDFEQVADVRTLGAIG 373 Query: 356 AIELFE 361 IEL E Sbjct: 374 VIELKE 379 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 431 Length adjustment: 32 Effective length of query: 394 Effective length of database: 399 Effective search space: 157206 Effective search space used: 157206 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory