Align Succinylornithine transaminase; SOAT; Succinylornithine aminotransferase; EC 2.6.1.81 (characterized)
to candidate WP_084201012.1 C0029_RS15270 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::Q8ZPV2 (408 letters) >NCBI__GCF_002869505.1:WP_084201012.1 Length = 426 Score = 131 bits (329), Expect = 4e-35 Identities = 100/288 (34%), Positives = 141/288 (48%), Gaps = 23/288 (7%) Query: 27 RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRFWHIGNGYTNEPALRL 86 R +G+R++D +GK YID+ +GH HPA+REA+ +Q+ + + G E ++L Sbjct: 38 RSDGARVYDCEGKAYIDYVLSWGPMIMGHNHPAVREAVIKQSEK--GLSFGAPTELEIQL 95 Query: 87 AKKLIDATFA-ERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGIVAFKNAFHGRT-LF 144 A ++ + + V NSG EA +A++LAR Y + IV F+ +HG + Sbjct: 96 ADRICEIMPGMDLVRMVNSGTEATMSAIRLARGYTG------RDTIVKFEGCYHGHSDSL 149 Query: 145 TVSAG------GQPTYSQDFAPLPPDIRHAAYND---LNSASALIDDNTCAVIVEPVQGE 195 V AG G P+ A L YND + +A A D+ VIVEPV G Sbjct: 150 LVKAGSGALTMGVPSSPGVPAALADHTMTLTYNDPEGVRAAFAEHGDSIACVIVEPVAGN 209 Query: 196 GGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTAKALG 255 IP FL+ LRE CD A+LI DEV TG R G A +GV D+ T K +G Sbjct: 210 MNCIPPEPGFLETLRECCDVSGAVLILDEVMTGF-RFGLQGAQGFFGVEADLTTLGKVVG 268 Query: 256 GGFPIGAM---LTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIIN 300 GG P+GA + + + P T GNP+A A LDII+ Sbjct: 269 GGMPVGAFGGKREIMEQIAPLGPVYQAGTLSGNPIAMAAGLATLDIIS 316 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 408 Length of database: 426 Length adjustment: 31 Effective length of query: 377 Effective length of database: 395 Effective search space: 148915 Effective search space used: 148915 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory