Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_102106348.1 C0029_RS13280 aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
Query= reanno::SB2B:6938540 (460 letters) >NCBI__GCF_002869505.1:WP_102106348.1 Length = 454 Score = 499 bits (1284), Expect = e-145 Identities = 242/440 (55%), Positives = 313/440 (71%), Gaps = 1/440 (0%) Query: 12 LQAMDAAHHLHPFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYGRK 71 L+ +D +HHLHPFTD D A G RV+ RAE +YI+ A+G+K+LD M+GLWC N+GY ++ Sbjct: 10 LKQLDQSHHLHPFTDFKDYATNGGRVMSRAEHIYIYTAEGHKMLDGMSGLWCCNLGYSQR 69 Query: 72 SIADAAYAQLQTLPFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTGSGSEANDTNLR 131 SI DA QL LP+YNNFFQC+++PAI LA + + P N VFFT SGSEANDTNLR Sbjct: 70 SIVDAVTEQLGQLPYYNNFFQCSNQPAIELAKALVDITPERFNHVFFTNSGSEANDTNLR 129 Query: 132 MVRRYWDLKGMPSKKTIISRKNAYHGSTVAGASLGGMGFMHQQGDLPIPGIVHIDQPYWF 191 +V RY+ +G P KK IISRKNAYHGST+A A LGGMG MH+Q + I + HI+QP+WF Sbjct: 130 LVSRYYQCQGRPEKKLIISRKNAYHGSTIAAACLGGMGPMHEQTN-GIDYVHHIEQPHWF 188 Query: 192 GEGRDMSPEAFGIKTAQALEAKILELGEDKVAAFIAEPFQGAGGVIIPPDSYWNEIKRIL 251 G D P FG++ A+ LE KI ELGE+ VAAFIAEP QGAGGVIIPPDSYW E++RI Sbjct: 189 EVGPDEDPNEFGLRVARQLEEKIDELGEENVAAFIAEPVQGAGGVIIPPDSYWPEVQRIC 248 Query: 252 EKYNILFILDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIVSDRVADV 311 + +IL I DEVI GFGRTG W+ ++T G++PDL+T AK +T+G+ P+GGV+V+D+VADV Sbjct: 249 NERDILLIADEVICGFGRTGQWWGSETYGIEPDLMTFAKAVTNGFQPLGGVMVADKVADV 308 Query: 312 LISDGGEFAHGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRLQTLSAHPL 371 L++ GEFAHG TYSGHP AAA L + IL+E ++ + P+ Q RLQ L+ H + Sbjct: 309 LLAHEGEFAHGLTYSGHPAAAAAGLATLNILKEGNVIADAAANIAPHFQRRLQELADHKI 368 Query: 372 VGEVRGMGMVGAIELVADKHSMVRFGSEISAGMLCREACIESGLVMRAVGDTMIISPPLC 431 VG+VRG GM A+ELV DK S +E + + CR E GL++R G+ MI++PPL Sbjct: 369 VGQVRGRGMFAAVELVKDKSSREPLAAESAGALFCRNTANELGLMVRQTGNAMIMAPPLI 428 Query: 432 ITRDEIDELIFKASQALSLT 451 + EID LI QAL +T Sbjct: 429 CSTSEIDSLIDMLGQALDVT 448 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 575 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 454 Length adjustment: 33 Effective length of query: 427 Effective length of database: 421 Effective search space: 179767 Effective search space used: 179767 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory