Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate WP_102106350.1 C0029_RS13315 CoA transferase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >NCBI__GCF_002869505.1:WP_102106350.1 Length = 387 Score = 517 bits (1332), Expect = e-151 Identities = 253/386 (65%), Positives = 296/386 (76%) Query: 1 MGALSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENT 60 MGALSH+RVLDLSR+LAGPWA Q+L DLGADVIKVE P GDDTR WGPP++ D GE T Sbjct: 2 MGALSHIRVLDLSRILAGPWASQMLGDLGADVIKVENPAGGDDTRRWGPPYMADEHGEAT 61 Query: 61 TEAAYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKA 120 EAAYYL ANRNK+SV ID PEGQ +RELAA+SD+LIENFKVGG A YGLDY SL A Sbjct: 62 AEAAYYLCANRNKRSVCIDMKAPEGQAQLRELAAQSDVLIENFKVGGAAKYGLDYASLSA 121 Query: 121 INPQLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDI 180 INP+L+YCSITGFGQTGP A R GYDF++Q +GGLMS+TG +G GAGP KVGVALTDI Sbjct: 122 INPRLVYCSITGFGQTGPLANRPGYDFLVQAMGGLMSVTGERDGKPGAGPQKVGVALTDI 181 Query: 181 LTGLYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHP 240 +TGLY+ I AALA R+H G GQH+D+ALLDV A LANQA NYL G P RLGNAHP Sbjct: 182 MTGLYAVIGIQAALAEREHSGLGQHVDLALLDVTAATLANQATNYLVGGMNPTRLGNAHP 241 Query: 241 NIVPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLI 300 NIVPYQ F +DG I+ VGNDGQFR++ EV G P+ ADD RF+TN RVANR L+PL+ Sbjct: 242 NIVPYQSFVASDGHLIVAVGNDGQFRRYVEVLGVPELADDARFSTNSQRVANRDALVPLL 301 Query: 301 RQATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVAS 360 + + + EW+ LEQAGVP GPIN +A+VFA+PQ+QAR + + L H L + + Sbjct: 302 QARMLERGKDEWIALLEQAGVPAGPINTVAEVFAEPQIQARDMQVNLSHPLNPDLQLAGN 361 Query: 361 PIRLSETPVEYRNAPPLLGEHTLEVL 386 PI+LS TPVEYR PP LGEHT EV+ Sbjct: 362 PIKLSRTPVEYRRPPPQLGEHTDEVI 387 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 602 Number of extensions: 21 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 387 Length adjustment: 31 Effective length of query: 375 Effective length of database: 356 Effective search space: 133500 Effective search space used: 133500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory