Align pipecolate oxidase (EC 1.5.3.7) (characterized)
to candidate WP_084199389.1 C0029_RS09780 FAD-binding oxidoreductase
Query= metacyc::G1G01-5614-MONOMER (432 letters) >NCBI__GCF_002869505.1:WP_084199389.1 Length = 426 Score = 129 bits (324), Expect = 2e-34 Identities = 121/407 (29%), Positives = 178/407 (43%), Gaps = 27/407 (6%) Query: 26 ALAGEHKADVCVIGGGITGLSAAIHLLEQGKSVIVLEAWKIGHGGSGRNVGLVNAGTWIR 85 AL GE DVCVIGGG TG+S A+ L E+G V +LE I G SGRN G V G Sbjct: 24 ALQGEVDTDVCVIGGGFTGVSTALTLAERGHRVTLLEQNLISWGASGRNGGQVIGGM--- 80 Query: 86 PDDVEATLGQKQGSRLNKV--LGEAPAEVF-AMIERLGIDCQAQHKGTLHMAHNATGIAD 142 + Q QG R N + LG ++ IE+ I C +H G + +A + D Sbjct: 81 -SGEKRLSKQWQGKRDNFMFELGYRGHQLIKERIEKYDIACDFKH-GYMDVALKPRQVRD 138 Query: 143 LEARHEQW--RRRGADVELLTGAQCQEYCGTDKISAALLDRRAGTINPMGYTQGLAAAVT 200 LE H + R G DV LL + ++ GTD+ L++ R G ++P+ G A A Sbjct: 139 LEEWHRELCERGMGEDVRLLDRGEVRDALGTDRYLGGLVNNRNGHLHPLNLCLGEARAAA 198 Query: 201 RLGGKIFQQSSVEGLEREGDGWRVKTARGAVRAEKVVISTGAYTEGDWSNLQKQFFRGYY 260 +LG I + + V +E G RV G+V A+ V+I+ AY + L + F Sbjct: 199 QLGASIHEHTKVLHIE-HGRRPRVICENGSVTADFVIIAGNAYHRLERKKLGGRVFPAGS 257 Query: 261 YQVASKPLQGIAADKVLPHGQGSWDTRTVLSSIRRDDQGRLLLGSLGRVD---NKPAWFV 317 Y +A++PL A +V D VL R R+L G GR D +PA Sbjct: 258 YILATEPLSEAEAAEVNALDVAVCDMNNVLDYFRLSADRRMLFG--GRCDYSGREPADIA 315 Query: 318 RSWADRIQSHYYPELGKVEWEMHWTGCIDFTPDHLMRLFEPAPGLVAVTGYNGRGNTTGT 377 + R+ S +P+L + W G + + + L + GY+G G Sbjct: 316 GAMLPRMHS-IWPQLRNKRIDYAWGGMMGIVVNRVPLLGRVTDNVFYSVGYSGHGVNMTH 374 Query: 378 VIGRAFAEFLLKGEADSL---------PIPFSPMSGVSAPSLRTAFY 415 G A A+ ++G D++ PIP G + + +Y Sbjct: 375 ACGEAMAD-AVEGSCDTMEFFASVPHWPIPLGQWLGAQSVAAGMLYY 420 Lambda K H 0.319 0.135 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 426 Length adjustment: 32 Effective length of query: 400 Effective length of database: 394 Effective search space: 157600 Effective search space used: 157600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory