Align crotonase (EC 4.2.1.150) (characterized)
to candidate WP_084200593.1 C0029_RS01675 enoyl-CoA hydratase
Query= metacyc::MONOMER-13469 (259 letters) >NCBI__GCF_002869505.1:WP_084200593.1 Length = 262 Score = 172 bits (436), Expect = 6e-48 Identities = 101/248 (40%), Positives = 144/248 (58%), Gaps = 2/248 (0%) Query: 12 GNVASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGSG-KAFVAGADIAEM 70 G+VA IT++ P A N + +L + A + + + N+YA++ITG+G K F AGAD+ Sbjct: 15 GHVAKITVDNPAA-NTWDTESLPGLAALVEALNAEKNIYALVITGAGQKFFSAGADLKIF 73 Query: 71 KDLTAVEGRKFSVLGNKIFRKLENLEKPVIAAINGFALGGGCELSLSCDIRIASSKAKFG 130 D K + + F L + IAAINGFA+GGG EL+++CDIRIA +A+ Sbjct: 74 ADGDPEAAGKMAAYFGQAFETLADFRGVSIAAINGFAMGGGLELAMACDIRIAEEQAQLA 133 Query: 131 QPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVNKVVEPDKLLEE 190 PE +G+ P GGTQRL + +G G AK +I G+ I A++A RIGLV +VV LE Sbjct: 134 LPEAKVGLLPCAGGTQRLTQLVGEGWAKRMILCGERIKADKAERIGLVEEVVATGTALER 193 Query: 191 AKALVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEAEVFGECFATEDRVEGMTAFVE 250 A AL + + +PI+V CK I+ I G+ E F F+TED+ EG+ AF+E Sbjct: 194 AMALAEQVGEQSPISVTACKKLIHSARDICIAQGLEDERSEFVALFSTEDQREGVNAFLE 253 Query: 251 KRDKAFKN 258 KR +KN Sbjct: 254 KRKPEWKN 261 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 262 Length adjustment: 25 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory