Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate WP_102106187.1 C0029_RS04910 crotonase/enoyl-CoA hydratase family protein
Query= CharProtDB::CH_091794 (261 letters) >NCBI__GCF_002869505.1:WP_102106187.1 Length = 269 Score = 146 bits (368), Expect = 5e-40 Identities = 92/261 (35%), Positives = 136/261 (52%), Gaps = 11/261 (4%) Query: 5 NVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVA 64 N I+E+EG V +VT+NRP+A NA + L M ++ D + ILT G+ +F A Sbjct: 7 NCIVEQEGNVLIVTLNRPEAKNAFSPQMLLGMYKAWRLLDEDDSLRCAILTANGD-TFCA 65 Query: 65 GADISE--------MKEMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIA 116 G D+ +E T+ G + + R KP+I AV G+AL GG EI Sbjct: 66 GMDLKAGADGDHGATEEFMTLMGEVPNVHWQALLRD-NRPNKPIILAVEGYALAGGTEIL 124 Query: 117 MSCDIRIASSNARFGQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRI 176 DIR+ + +A FG EV G+ P G T RL R + +A +++ +++ A +AL I Sbjct: 125 QGTDIRVGAEDAVFGVTEVARGLYPMSGSTVRLRRQIPYCLAAEILLCGEHVSAQQALDI 184 Query: 177 GLVNKVVEPSELMNTAKEIANKIVSNAPVAVKLSKQAINRGMQC-DIDTALAFESEAFGE 235 GL+NK+V ++ AKE A KI +N P+AVK Q++ +C D A+ G Sbjct: 185 GLINKIVPKGTTLDAAKEYAAKICANGPLAVKAVVQSLREHQECMSEDDAMVASDALAGP 244 Query: 236 CFSTEDQKDAMTAFIEKRKIE 256 F++ D K+ M AF EKR E Sbjct: 245 VFASNDAKEGMRAFKEKRPAE 265 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 269 Length adjustment: 25 Effective length of query: 236 Effective length of database: 244 Effective search space: 57584 Effective search space used: 57584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory