Align L-lysine 2,3-aminomutase; LAM; KAM; EC 5.4.3.2 (characterized)
to candidate WP_084197976.1 C0029_RS16475 EF-P beta-lysylation protein EpmB
Query= SwissProt::Q9XBQ8 (416 letters) >NCBI__GCF_002869505.1:WP_084197976.1 Length = 334 Score = 187 bits (476), Expect = 3e-52 Identities = 113/326 (34%), Positives = 176/326 (53%), Gaps = 7/326 (2%) Query: 19 DWRWQVRNRIETVEELKKYIPLTKEEEEGVAQCVKSLRMAITPYYLSLIDPNDPNDPVRK 78 DWR ++R+ + E L + L E+ A + + + YL I P DP+DP+ + Sbjct: 11 DWRSELRHAVSDGETLLARLQLNPEQLGYSALAARDFPVLVPRPYLQRITPGDPDDPLLR 70 Query: 79 QAIPTALELNKAAADLEDPLHEDTDSPV--PGLTHRYPDRVLLLITDMCSMYCRHCTRRR 136 Q + T E +DP+ E T + + PG+ +Y RVLL++ C++ CR+C RR Sbjct: 71 QVLATGQETLVEPGYSDDPVGE-TGATIQRPGVIQKYRGRVLLILAGGCAINCRYCFRRH 129 Query: 137 FAGQSDDSMPMERIDKAIDYIRNTPQVRDVLLSGGDALLVSDETLEYIIAKLREIPHVEI 196 F Q + + E + +A++++ + +V+LSGGD LLV+D L ++A + IPHV Sbjct: 130 FPYQENRNSRQEWL-QALEHVAADTSITEVILSGGDPLLVADAALAELVATIAAIPHVRR 188 Query: 197 VRIGSRTPVVLPQRITPELVNML--KKYHPVWLNTHFNHPNEITEESTRACQLLADAGVP 254 +R+ +R PVV+PQR+T L+ L + V + H NH E+ +A Q L +A V Sbjct: 189 LRVHTRLPVVIPQRVTDGLLQALTGSRLRCVMV-IHSNHARELDASVAQAMQRLREADVE 247 Query: 255 LGNQSVLLRGVNDCVHVMKELVNKLVKIRVRPYYIYQCDLSLGLEHFRTPVSKGIEIIEG 314 L NQSVLL GVN+ + L +L +I VRPYY++ D G HF P ++GI +I+ Sbjct: 248 LLNQSVLLAGVNNHAATLVNLSERLFEIGVRPYYLHLLDKVRGAAHFDVPQAEGIALIDA 307 Query: 315 LRGHTSGYCVPTFVVDAPGGGGKTPV 340 + GY VP V + G GKT + Sbjct: 308 MATELPGYLVPRLVHEEAGQPGKTRI 333 Lambda K H 0.320 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 334 Length adjustment: 30 Effective length of query: 386 Effective length of database: 304 Effective search space: 117344 Effective search space used: 117344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory