Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate WP_084200120.1 C0029_RS04725 CoA transferase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >NCBI__GCF_002869505.1:WP_084200120.1 Length = 400 Score = 254 bits (650), Expect = 2e-72 Identities = 152/406 (37%), Positives = 221/406 (54%), Gaps = 15/406 (3%) Query: 4 LSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTR---AWGPPFLKDARGENT 60 L+ +RVLDL+ +L+GP+ ILADLGA+ IKVE P G+ TR A P D G Sbjct: 6 LAGVRVLDLTHMLSGPYGAMILADLGAETIKVE-PLQGEGTRKLLATDPANSLDGMG--- 61 Query: 61 TEAAYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKA 120 AY+++ NRNKQSV ID G+ L +SDI+I NF G G+DY +L Sbjct: 62 ---AYFITLNRNKQSVAIDLKSTAGKAEFYRLVEQSDIVISNFGAGVPERLGIDYATLSE 118 Query: 121 INPQLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDI 180 INP++I C++TGFG GP K +D + Q GG MS+T G + PV+ G+ + D+ Sbjct: 119 INPRIITCTVTGFGSDGPSCKDPAFDQVAQATGGGMSIT----GVDTDHPVRAGIPIGDL 174 Query: 181 LTGLYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHP 240 G++ ILAAL R+ G GQH+D+A+LD Q++ L A + +G P +GNAH Sbjct: 175 GGGMFGVMGILAALYEREQSGHGQHVDIAMLDCQISLLNYMATMHFLSGEDPYPIGNAHF 234 Query: 241 NIVPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLI 300 VPY F ADG ++ V D ++ +V P + DDP R A + V+ + Sbjct: 235 VHVPYNTFRCADGFIVIAVITDNFWQNLKQVVPCPAF-DDPALDEQPGRWAAKDVIEENL 293 Query: 301 RQATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVAS 360 ++ W+ +L+Q +PC P+N L+Q DPQV+ R + +EL H + Sbjct: 294 NAMLQEQSCDYWLEKLKQQRIPCAPVNQLSQALRDPQVKHRNMVVELHHPDGDSTYGPGN 353 Query: 361 PIRLSETPVEYRNAPPLLGEHTLEVLQRVLGLDEAAVMAFREAGVL 406 PI+LS + A PLLG+HT V +LG D+A + ++ GV+ Sbjct: 354 PIKLSRADDDVFTAAPLLGQHTDNVFTELLGYDQAHITRLKQQGVI 399 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 400 Length adjustment: 31 Effective length of query: 375 Effective length of database: 369 Effective search space: 138375 Effective search space used: 138375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory