GapMind for catabolism of small carbon sources

 

Alignments for a candidate for mcm-small in Halioglobus japonicus S1-36

Align methylmalonyl-CoA mutase (subunit 1/2) (EC 5.4.99.2) (characterized)
to candidate WP_084199764.1 C0029_RS11185 methylmalonyl-CoA mutase

Query= BRENDA::O58013
         (147 letters)



>NCBI__GCF_002869505.1:WP_084199764.1
          Length = 719

 Score =  109 bits (272), Expect = 1e-28
 Identities = 54/128 (42%), Positives = 85/128 (66%), Gaps = 7/128 (5%)

Query: 11  RVLVAKPGLDGHDRGAKVVARALRDAGYEVIYTGIRQTPEQIVEAVIEEDVDVLGISILS 70
           R+LV K G DGHDRGAKVVA A  D G+++  + +  TPE++    IE DV V+G S L+
Sbjct: 591 RMLVCKMGQDGHDRGAKVVATAFADVGFDIDLSPMFSTPEEVARQAIENDVHVVGASSLA 650

Query: 71  GAHMVLIPKILKLLEEKGIKVNEDVLVVAGGIIPPDDAEELKKMGVAEVFGPGTPL---- 126
             H  L+P++++ L+++G    +D++V+AGG+IP  D + L   GV  +FGPGTP+    
Sbjct: 651 AGHKTLVPELVEELKKQGA---DDIVVIAGGVIPRQDYDYLYGAGVKCIFGPGTPIPACA 707

Query: 127 REIIEFID 134
           RE+++ ++
Sbjct: 708 REVLDAVN 715


Lambda     K      H
   0.318    0.140    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 209
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 147
Length of database: 719
Length adjustment: 27
Effective length of query: 120
Effective length of database: 692
Effective search space:    83040
Effective search space used:    83040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory