Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_076948407.1 C1M55_RS22600 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_002893965.1:WP_076948407.1 Length = 267 Score = 212 bits (540), Expect = 6e-60 Identities = 118/259 (45%), Positives = 168/259 (64%), Gaps = 11/259 (4%) Query: 11 LLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTL 70 +LT+ +++ FGG+ A++DV F + G+I +IGPNGAGKTTLFNCIT Y P+ G +T Sbjct: 16 VLTLSDVSIEFGGVTALDDVGFDVHAGQICGLIGPNGAGKTTLFNCITRIYEPSRGVITW 75 Query: 71 RHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFSIA 130 + D LL P Y ++ A +ARTFQN+ LF GMSV +N +V ++ F +A Sbjct: 76 QGTD----LLGLRP-YALAS-AGIARTFQNLALFSGMSVFDNTMVGGSSR----GRFGLA 125 Query: 131 -GLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVM 189 GLLG P RE + A Y L+R+ L++ A+ A LP+G +R+E+ARA+ +EP + Sbjct: 126 SGLLGWPPARARVRELREKAWYLLERLELVDVANAPAAGLPFGTLKRVELARALMSEPSL 185 Query: 190 LCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKIS 249 L LDEPA GL E EL +L+ +RD+ G LL+EH M +V+ ISDHVV L++G KI+ Sbjct: 186 LLLDEPAGGLTHSEVKELGELIVSLRDDFGFGALLVEHHMGLVLGISDHVVALNFGHKIA 245 Query: 250 DGDPAFVKNDPAVIRAYLG 268 +G PA ++ + AVI AYLG Sbjct: 246 EGTPAEIQQNDAVINAYLG 264 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 267 Length adjustment: 26 Effective length of query: 268 Effective length of database: 241 Effective search space: 64588 Effective search space used: 64588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory