Align D-serine/D-alanine/glycine transporter (characterized)
to candidate WP_021333985.1 C1M55_RS07700 amino acid permease
Query= SwissProt::P0AAE0 (470 letters) >NCBI__GCF_002893965.1:WP_021333985.1 Length = 463 Score = 369 bits (946), Expect = e-106 Identities = 186/445 (41%), Positives = 279/445 (62%), Gaps = 4/445 (0%) Query: 10 DDQAPAEQSLRRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVYMIIGFMLFF 69 + A + L+R LT RHI+ IA+G AIGTGLF GS + I AGPS++ Y+I G ++ Sbjct: 2 NSDAATQDGLKRGLTARHIRFIALGSAIGTGLFYGSAEAIKRAGPSVLLAYLIGGIAVYL 61 Query: 70 VMRAMGELLLSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFW 129 V+RA+GE+ + N SFS++A+ LGP AG+ TGWTY F V+ +ADV A Y QFW Sbjct: 62 VLRALGEMAVRNPVSGSFSEYANKHLGPLAGFMTGWTYTFEMVIVCLADVTAFGLYMQFW 121 Query: 130 FPDLSDWVASLAVIVLLLTLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGLVMVAMHFQS 189 FPD+ W+ LAV+ + +NL +VK+FGE+EFWF ++KI AI+++I G+ ++ F Sbjct: 122 FPDVPRWIWVLAVVFFIGAINLLSVKVFGELEFWFTLVKITAIIAMIAGGIAIIVFGF-G 180 Query: 190 PTGVEASFAHLWNDGGWFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKDPEKSLPRAI 249 +A +HLW+DGG+F G GF A F I +FAF G E++G TA E +DP +++ +A+ Sbjct: 181 VHDTDAGISHLWSDGGFFATGFGGFVACFAIVMFAFGGTEIIGITAGEAEDPAQTIRKAV 240 Query: 250 NSIPIRIIMFYVFALIVIMSVTPWSSVVPEKSPFVELFVLVGLPAAASVINFVVLTSAAS 309 N++P+RII+FY+ L VIM++ PW ++ + SPFV++F +GL AAS++N VV+T+A S Sbjct: 241 NTVPVRIILFYICTLAVIMAIIPWQTINSDNSPFVQIFENLGLGTAASILNIVVITAALS 300 Query: 310 SANSGVFSTSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVVMLYVNPSVI 369 + NS VF RM+FG++ G AP+ ++S VP + + LL GVV+ Y+ P + Sbjct: 301 AINSDVFGAGRMMFGMSHAGQAPQVMKRVSANGVPWMTVVIMTVALLVGVVLNYLIPDQV 360 Query: 370 GAFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSI-YKMPLGKLMCWVCMAFFVF 428 F +I +++ +FVW +IL S R Q ++ + +PL + F F Sbjct: 361 --FLVIASLATFATIFVWIMILLSQFRSRAQMSADETAALKFPVPLWPYGQIFAIVFLAF 418 Query: 429 VVVLLTLEDDTRQALLVTPLWFIAL 453 V+VLL + DTR ALLV W + L Sbjct: 419 VIVLLGVIADTRVALLVGAGWLVLL 443 Lambda K H 0.329 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 619 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 463 Length adjustment: 33 Effective length of query: 437 Effective length of database: 430 Effective search space: 187910 Effective search space used: 187910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory