Align actP-like component of L-lactate and L-malate uptake system (characterized)
to candidate WP_003939876.1 C1M55_RS22765 cation acetate symporter
Query= reanno::PV4:5209923 (572 letters) >NCBI__GCF_002893965.1:WP_003939876.1 Length = 545 Score = 177 bits (448), Expect = 1e-48 Identities = 151/570 (26%), Positives = 261/570 (45%), Gaps = 75/570 (13%) Query: 2 DVQTLTYLIVGFTFALYIGIAIWSRAGST----KEFYVAGGGVHPVMNGMATAADWMSAA 57 DV + I F + + + + RA T +FY GG NG A A D++SAA Sbjct: 11 DVGNPAFNIAIFLAFVVVTMTLVIRASRTTKKASDFYTGGGQFTGPQNGFAIAGDYLSAA 70 Query: 58 SFISLAGIVSFVGYDGSVYLMGWTGGYVLLALCMAPYLRKFGKFTVPDFIGDRYYSQAAR 117 SF+ +AG ++ GYDG +Y +G+ +++ L +A LR G+FT+ D + R + R Sbjct: 71 SFLGIAGAIAVYGYDGFLYSIGFLVAWLVALLLVAELLRNTGRFTMADVLSFRLKQRPVR 130 Query: 118 TVAVVCAIFICFTYIAGQMRGVGVVFSRFLEVEVDTGVYIGMAVV----FFYAVLGGMKG 173 A + + + Y+ QM G G + + L ++ G I +A+V Y ++GGMKG Sbjct: 131 MAAALSTLAVSLFYLLAQMAGAGGLVALLLNIDGKVGQSIVVAIVGVLMIVYVLVGGMKG 190 Query: 174 ITYTQVAQYCVLIFAFMVPAIFISVMMTGHILPQLGFGAELVDAAGNNTGVYLLEKLDGL 233 TY Q+ + +L+ + + + + G+ L ++V+++ GV + L G Sbjct: 191 TTYVQMVKAVLLVAGAGIMFVLVLWAVRGNFSQLLANAQDMVNSS-TTKGVQGRDIL-GP 248 Query: 234 SAQLGFSQYTEGSKGMIDVFFITGALMFGTAGLPHVIVRFFTVPKVKDARVSAGWALVFI 293 A+ G S T+ +D + AL+ GTAGLPHV++RF+TVP K+AR S WA+ I Sbjct: 249 GAKYGLSGMTK-----LDFISLGIALVLGTAGLPHVLMRFYTVPTAKEARRSVTWAIALI 303 Query: 294 AIMYTTIPALAAFSRVNMIETINGPESTGVAYETAPDWIKNWEKTGLIKWDDKNNDGKIY 353 Y L G A PD KI Sbjct: 304 GAFYLFTLVL----------------GYGAASMVGPD--------------------KIL 327 Query: 354 YAKGETNEMKIDRDIMVLATPEIA-NLPAWV-IALVAAGGLAAALSTSAGLLLVISTSVS 411 A G+ N A P +A L + + +++A A L+ AGL + S S + Sbjct: 328 AAPGKEN----------AAAPLLAFELGGTIFLGIISAVAFATILAVVAGLAITASASFA 377 Query: 412 HDLLKKNF-MPDISDKQELLYARIAAALGIVMAGYFGINPPG-FVAAVVAIAFGLAASSL 469 HD+ + +++Q++ +RI + +++ GI G +A +VA+AF +AAS+ Sbjct: 378 HDIYASVIKRGNATEEQQVRVSRITVVVIGLVSIVLGIMAMGQNIAFLVALAFAVAASAN 437 Query: 470 FPAIIMGIFSRTMNKEGAIAGMVIGLLFSASYIIYFKFVNPGDN----NASNWLFGISPE 525 P ++ +F + N GA+ + GL+ + I++ V+ + N+ F +S Sbjct: 438 LPTLLYSLFWKKFNTTGALFSIYGGLVSCLTLIVFSPAVSGKPSSMFPNSDFAWFPLSNP 497 Query: 526 GIGMLGMIINFAVAFIVSKVTAAVPQNVVD 555 G I++ +AF++ V + +N ++ Sbjct: 498 G------IVSIPLAFVLGIVGTYIGRNKIE 521 Lambda K H 0.326 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 791 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 572 Length of database: 545 Length adjustment: 36 Effective length of query: 536 Effective length of database: 509 Effective search space: 272824 Effective search space used: 272824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory