Align Lactate utilization protein A (characterized)
to candidate WP_050654582.1 C1M55_RS26555 (Fe-S)-binding protein
Query= SwissProt::O07020 (238 letters) >NCBI__GCF_002893965.1:WP_050654582.1 Length = 249 Score = 188 bits (478), Expect = 7e-53 Identities = 101/242 (41%), Positives = 143/242 (59%), Gaps = 5/242 (2%) Query: 1 MKVSLFVTCLVDMFQTNVGKATVELLERLGCEVDFPEGQICCGQPAYNSGYVHDAKKAMK 60 M+V+LF TC+ D + KAT LL RLG +V FP GQ CCGQ N+GY A + Sbjct: 1 MRVALFATCIGDTMFPDAVKATALLLTRLGHDVVFPSGQTCCGQTHVNTGYQPGALPLVA 60 Query: 61 RMIETFQDS--EYVVSPSGSCTTMFREYPHLFQDDPKWAD---KAKKLADKTYELTDFIV 115 +TF D+ + VV+PSGSC R + + A + + + KTYEL++F+V Sbjct: 61 NYADTFGDASIDAVVAPSGSCVGSVRHQHEIVAERYGTASLCGQVQTVKAKTYELSEFLV 120 Query: 116 NVLGVEDVGATLHTKATLHTSCHMTRLLGVRKEPMKLLSHVKGLQFTELPGKHNCCGFGG 175 +VLGV DVGA + T H +CH R+L V +P++LL +V+ + ELP +CCGFGG Sbjct: 121 DVLGVTDVGAYFPHRVTYHPTCHSLRMLRVGDKPLQLLRNVRDIDLVELPEADSCCGFGG 180 Query: 176 TFSVKMAQISEQMVDEKVECVEETGAEVLIGADCGCLMNIGGRLGRKDKNVKVMHIAEVL 235 TF++K A+ S M+ +K+ V +TGAE D CLM+IGG + R K +H+AE+L Sbjct: 181 TFAIKNAETSTAMLADKIRHVADTGAEFCSAGDSSCLMHIGGGMSRLQMGAKTIHLAEIL 240 Query: 236 NS 237 S Sbjct: 241 AS 242 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 249 Length adjustment: 23 Effective length of query: 215 Effective length of database: 226 Effective search space: 48590 Effective search space used: 48590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory