Align PTS system N-acetylglucosamine-specific EIIC component; PTS system GlcNAc-specific EIIC component; GlcNAc-specific transporter; N-acetylglucosamine permease IIC component; GlcNAc permease IIC component (characterized)
to candidate WP_003941307.1 C1M55_RS19660 PTS transporter subunit EIIC
Query= SwissProt::Q9S2H4 (416 letters) >NCBI__GCF_002893965.1:WP_003941307.1 Length = 447 Score = 422 bits (1084), Expect = e-122 Identities = 214/406 (52%), Positives = 281/406 (69%), Gaps = 5/406 (1%) Query: 7 TAAPAKKRGSGLFQGLQKVGRSLQLPIAVLPAAGIMVRLGQDDIFGKDGLGWDKVAAVFN 66 T K+ S +F G+Q++GRSL LPIAVLPAAGI++RLGQDD+ G+ AAV + Sbjct: 2 TLEDTPKKESKVFAGVQRLGRSLMLPIAVLPAAGILLRLGQDDLLGRFS-SMHSAAAVIS 60 Query: 67 NAGGALTGSLPILFCIGVAIGFAKKADGSTALAAVVGFLVYSKVLEAFP--VTEAVVQDG 124 AG A+ LP++F +G+AIG+AKKADGSTALAAVVG++V V +A V E Sbjct: 61 AAGQAVFTWLPLIFAVGIAIGWAKKADGSTALAAVVGYMVIDGVFKAMSPIVLEGKTDPN 120 Query: 125 ADVAATYNDPGVLGGIIMGLLAAVLWQRYHRKKLVDWLGFFNGRRLVPIIMAFVGIVVGV 184 D + + GVL GI+MGLL+A+LWQR++R KL D+LGFFNGRRLVPI+ A G+VVGV Sbjct: 121 GDQSLI--NYGVLAGIVMGLLSAILWQRFYRTKLPDYLGFFNGRRLVPILTAITGLVVGV 178 Query: 185 FFGLVWEPIGDGISNFGEWMTGLGSGGAALFGGVNRALIPVGMHQFVNTVAWFQLGDFTN 244 V+ G++ GE + G ++G NR LIP G+H +N+ WF +GD+ + Sbjct: 179 LMAFVYPLFNSGLNWVGEAVASNTVVGGGIYGAANRLLIPTGLHHILNSAVWFLIGDYQD 238 Query: 245 SAGDVVHGDITRFLAGDPSAGIFQAGFFPIMMFGLPAAALAMAHTARPERRKAVLGMMIS 304 ++G +V GD+ RF AGDPSAG F GFFPIMMF LPAAA A+ A+P ++K V G+M+S Sbjct: 239 ASGQIVRGDLNRFFAGDPSAGTFMTGFFPIMMFALPAAAFAIWRNAKPSQKKLVGGIMLS 298 Query: 305 LAATSFVTGVTEPIEFSFMFIAPVLYVLHAVLTAISMAITWGLGVHAGFNFSAGFIDYAL 364 T+F+TG+TEP+EFSFMF+A LYV+H++LT SMA+ LG+H GF FSAGF DY L Sbjct: 299 TGLTAFLTGITEPLEFSFMFVAWPLYVIHSLLTGTSMALVNALGIHDGFTFSAGFFDYVL 358 Query: 365 NWHLATKPWLIIPIGLVFAAIYYVTFRFAIVKFNLKTPGREPEEEV 410 N+ AT W++IPIGL +A IYY F F I K+NL+TPGRE E EV Sbjct: 359 NFGKATNAWMLIPIGLGYAVIYYFLFSFVIKKWNLRTPGREEEVEV 404 Lambda K H 0.326 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 654 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 447 Length adjustment: 32 Effective length of query: 384 Effective length of database: 415 Effective search space: 159360 Effective search space used: 159360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory