Align Asparagine permease (AnsP) of 497 aas and 12 TMSs (characterized)
to candidate WP_021333985.1 C1M55_RS07700 amino acid permease
Query= TCDB::P40812 (497 letters) >NCBI__GCF_002893965.1:WP_021333985.1 Length = 463 Score = 321 bits (823), Expect = 3e-92 Identities = 162/445 (36%), Positives = 258/445 (57%), Gaps = 11/445 (2%) Query: 21 AHEEGYHKAMGNRQVQMIAIGGAIGTGLFLGAGARLQMAGPALALVYLICGIFSFFILRA 80 A ++G + + R ++ IA+G AIGTGLF G+ ++ AGP++ L YLI GI + +LRA Sbjct: 6 ATQDGLKRGLTARHIRFIALGSAIGTGLFYGSAEAIKRAGPSVLLAYLIGGIAVYLVLRA 65 Query: 81 LGELVLHRPSSGSFVSYAREFLGEKAAYVAGWMYFINWAMTGIVDITAVALYMHYWGAFG 140 LGE+ + P SGSF YA + LG A ++ GW Y + + D+TA LYM +W F Sbjct: 66 LGEMAVRNPVSGSFSEYANKHLGPLAGFMTGWTYTFEMVIVCLADVTAFGLYMQFW--FP 123 Query: 141 DVPQWVFALGALTIVGTMNMIGVKWFAEMEFWFALIKVLAIVIFLVVGTIFLGTGQPLEG 200 DVP+W++ L + +G +N++ VK F E+EFWF L+K+ AI+ + G + G + Sbjct: 124 DVPRWIWVLAVVFFIGAINLLSVKVFGELEFWFTLVKITAIIAMIAGGIAIIVFGFGVHD 183 Query: 201 NATGFHLITDNGGFFPHGLLPALVLIQGVVFAFASIELVGTAAGECKDPQKMVPKAINSV 260 G + +GGFF G + V+FAF E++G AGE +DP + + KA+N+V Sbjct: 184 TDAGISHLWSDGGFFATGFGGFVACFAIVMFAFGGTEIIGITAGEAEDPAQTIRKAVNTV 243 Query: 261 IWRIGLFYVGSVVLLVLLLPWNAYQAGQSPFVTFFSKLGVPYIGSIMNIVVLTAALSSLN 320 RI LFY+ ++ +++ ++PW + SPFV F LG+ SI+NIVV+TAALS++N Sbjct: 244 PVRIILFYICTLAVIMAIIPWQTINSDNSPFVQIFENLGLGTAASILNIVVITAALSAIN 303 Query: 321 SGLYCTGRILRSMSMGGSAPKFMAKMSRQHVPYAGILATLVVYVVGVFLNYLVPSRVFEI 380 S ++ GR++ MS G AP+ M ++S VP+ ++ V +VGV LNYL+P +VF + Sbjct: 304 SDVFGAGRMMFGMSHAGQAPQVMKRVSANGVPWMTVVIMTVALLVGVVLNYLIPDQVFLV 363 Query: 381 VLNFASLGIIASWAFIMVCQMRLRQAIKEGKAADVSFKLPGAPFTSWLTLLFLLSVLVLM 440 + + A+ I W I++ Q R R + + A + F +P P+ ++FL V+VL+ Sbjct: 364 IASLATFATIFVWIMILLSQFRSRAQMSADETAALKFPVPLWPYGQIFAIVFLAFVIVLL 423 Query: 441 AFDYPNGTYTIASLPLIAILLVAGW 465 + + +A+L+ AGW Sbjct: 424 G---------VIADTRVALLVGAGW 439 Lambda K H 0.328 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 655 Number of extensions: 31 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 463 Length adjustment: 34 Effective length of query: 463 Effective length of database: 429 Effective search space: 198627 Effective search space used: 198627 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory