Align Ornithine aminotransferase; OAT; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_007736227.1 C1M55_RS16390 acetylornithine transaminase
Query= SwissProt::P38021 (401 letters) >NCBI__GCF_002893965.1:WP_007736227.1 Length = 399 Score = 254 bits (649), Expect = 3e-72 Identities = 146/387 (37%), Positives = 213/387 (55%), Gaps = 17/387 (4%) Query: 20 NNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQALKDQADKITLTS 79 NNY + + GA + D +G +Y+D L+ + GH HP +++A+ Q + S Sbjct: 16 NNYGVPRVALVRGDGAVLTDADGKQYVDFLAGIAVNILGHGHPAVVEAVTTQLSTLGHVS 75 Query: 80 RAFHNDQLGPFYEKT----AKLTGKEMILPMNTGAEAVESAVKAARRWAYEVKGVADNQA 135 + ++ + E+ +TG+ N+G EA E+A K AR A + Sbjct: 76 NLYASEPVVELAEQLLAHLGNVTGRAFFC--NSGTEANEAAFKLAR---------ATGRK 124 Query: 136 EIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALRQAITPNTAAFLF 195 +IIA G+FHGRTM A++L+ + + F PM G++ +PYGDVEAL QA+ +TAA Sbjct: 125 KIIAAEGSFHGRTMGALALTGQPAKRAPFEPMPAGVEFVPYGDVEALEQAVDSDTAAVFL 184 Query: 196 EPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDWDGIVPDMYI 255 EPI GE G+V+PPEG+L EA I E L + DE+QTG+GRTG +A GIVPD+ Sbjct: 185 EPIMGEGGVVVPPEGYLVEARRITAERGALLVLDEVQTGIGRTGWFYAHQAVGIVPDVIT 244 Query: 256 LGKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSIASLEVLEDEKLADRS 315 L K LGGG+ PI A +F PG HG+TFGGNP+ A ++A L+ + E L R+ Sbjct: 245 LAKGLGGGM-PIGACIATGATAELFGPGKHGTTFGGNPVCAAAALAVLKTIAAEDLISRA 303 Query: 316 LELGEYFKSELESIDSPVIKEVRGRGLFIGVELTEAARPYCER-LKEEGLLCKETHDTVI 374 LG+ + +E + P++ VRG GL +GV LTE P E +E G L VI Sbjct: 304 DSLGKSISAGIEDLGHPLVDYVRGSGLLLGVVLTEDVAPAVENAAREAGYLVNAAQPGVI 363 Query: 375 RFAPPLIISKEDLDWAIEKIKHVLRNA 401 R APPLI++ E + + + + +A Sbjct: 364 RLAPPLILTDEQAETFVAALPAIFDSA 390 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 399 Length adjustment: 31 Effective length of query: 370 Effective length of database: 368 Effective search space: 136160 Effective search space used: 136160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory