Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate WP_076948461.1 C1M55_RS14045 aspartate aminotransferase family protein
Query= BRENDA::Q9FNK4 (475 letters) >NCBI__GCF_002893965.1:WP_076948461.1 Length = 408 Score = 172 bits (436), Expect = 2e-47 Identities = 118/383 (30%), Positives = 193/383 (50%), Gaps = 16/383 (4%) Query: 61 VFSRANGSTIWDPEGKRYIDFLAAYSAVNQGHCHPKIMKALQEQVEKLTLSSRA--FYND 118 V SR G+ IWD EG RY+D A N GH +I A+ Q+ K+ S F + Sbjct: 23 VVSRGEGAYIWDREGTRYLDATAGLWFTNVGHGRTEIADAVAAQLSKIAHFSNFGDFVPE 82 Query: 119 KFPVFAERLTNM--FGYDMVLPMNTGAEGVETALKLARKWGHEKKNIPKDEAIIVSCCGC 176 V AERL + + + G++ V+TA KLAR++ HE ++AIIV Sbjct: 83 TTQVLAERLAAIAPVAGSKIFFTSGGSDSVDTAAKLARRYWHEVGQ--PEKAIIVGRQKA 140 Query: 177 FHGRTLAIVSMSCDNDATRGFGPLLPGNLKVDFGDADSLEKIFKEKG-DRIAGFLFEPIQ 235 +HG +A +++ G+G L+ V + DA SL ++ ++ G ++IA F EPI Sbjct: 141 YHGMHVAGTALAGIPVNREGYGELMADAATVGWDDAKSLLELIEKIGANKIAAFFAEPII 200 Query: 236 GEAGVIIPPDGYLKAVRELCTKYNVLMIADEVQSGLAR-SGKMLACDWEEIRPDMVILGK 294 G GV +PP+GYL VR++C ++++L + DEV +G R G+ A +++PDM+ K Sbjct: 201 GAGGVYLPPEGYLAEVRDICREHDILFVVDEVVTGFGRIGGEWFASTRFDLKPDMMTTAK 260 Query: 295 ALGGGVIPVSAVLADKDVMLHIKPG---QHGSTFGGNPLASAVAMASLDVIVEEKLVERS 351 L G +P+ AV V G +HG T+GG+ A+A AMA+LD++ E L+ S Sbjct: 261 GLTSGYVPMGAVFIAPRVAEPFYAGSWWRHGYTYGGHAGAAAAAMANLDILERENLLAES 320 Query: 352 ASLGEELRIQLNEIKKQFPKYIKEVRGRGLFNAIEFNSESLSPVSAYDICLSLKERGVLA 411 L L L + + P+ + G G A++ P A +L+E G+ Sbjct: 321 KRLEASLHTHLQPL-AEHPRVAEVRSGLGAVAAVQL----ADPAEALPFVKTLREHGISG 375 Query: 412 KPTHNTIVRLTPPLSISSDELRD 434 + ++++P ++ D++ + Sbjct: 376 RAAGQGAMQISPTFVMTDDQVAE 398 Lambda K H 0.318 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 475 Length of database: 408 Length adjustment: 32 Effective length of query: 443 Effective length of database: 376 Effective search space: 166568 Effective search space used: 166568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory