Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate WP_007730024.1 C1M55_RS26585 ABC transporter permease
Query= uniprot:A0A0C4Y7K0 (337 letters) >NCBI__GCF_002893965.1:WP_007730024.1 Length = 347 Score = 186 bits (472), Expect = 7e-52 Identities = 111/294 (37%), Positives = 170/294 (57%), Gaps = 4/294 (1%) Query: 33 LGMLPVLVLLCIGFSVLTENFAGWQNLSIIAQQASINMVLAAGMTFVILTGGIDLSVGSI 92 L ML V V + FS T +F + NLS +A Q + +++A MTFVI G IDLSVG+I Sbjct: 30 LAMLAVTVAVAAVFSATTSSFLTFTNLSNLATQIAPVLIIAVAMTFVITAGQIDLSVGAI 89 Query: 93 LS-ISAVVAMLVSLMPQLGMLSVPAALLCGLLFGIVNGALVAFMKLPPFIVTLGTLTAVR 151 ++ ++A+ A L+ ++ V A ++ G +G+VNG L A+ +PPFIVTL T++ +R Sbjct: 90 VAFVAAMSAELIQAGVDSSLVFVAAPVM-GAAWGLVNGWLAAYQGIPPFIVTLATMSVIR 148 Query: 152 GLARLVGNDSTIYNP-DIGFAFIGNGEVLGVPWLVIIAFAVVAVSWFVLRRTVLGLQIYA 210 G+A ++ P D FA +G E LG IA VV + L R G + Sbjct: 149 GIALYRTEGFSVPVPADTYFAKLGTSEFLGFSASAWIALVVVVIGAIALNRMRFGRYVTG 208 Query: 211 VGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQLGQSYELDAIAA 270 +G N E+ R SG+ VL+ +GL AG+ G++ +ARL + +EL I A Sbjct: 209 IGSNVESVRRSGVNTRRVLMMTLVFTGLAAGIAGLLIAARL-GSGSANSATGFELTVITA 267 Query: 271 VILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLVIIGAV 324 V+LGGT+ GG G+++GT++GA++ +++NGL LLGVS II G+V++ A+ Sbjct: 268 VVLGGTNLFGGRGTVIGTVIGAVLTGIIANGLTLLGVSPFLTPIITGVVLLLAI 321 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 347 Length adjustment: 29 Effective length of query: 308 Effective length of database: 318 Effective search space: 97944 Effective search space used: 97944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory