Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate WP_003944440.1 C1M55_RS07370 amino acid ABC transporter permease
Query= uniprot:B2TBJ8 (250 letters) >NCBI__GCF_002893965.1:WP_003944440.1 Length = 324 Score = 90.5 bits (223), Expect = 4e-23 Identities = 74/246 (30%), Positives = 125/246 (50%), Gaps = 15/246 (6%) Query: 11 TIKQLLAAVPTTLGLFFCSLILGGLLSLVIVTMRVSPHWLPNRFARAYILVFRGSPLLIQ 70 T K +LAA+ T+ L ILG L + + R+S + + A YI FR PL++Q Sbjct: 67 TAKSVLAALWMTIKLTLWGTILGFGLGVFLALGRLSKNPVLQVIAWTYIWAFRSIPLIVQ 126 Query: 71 M---FLVYY-----GMG-QFGVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGGLM 121 + F + Y +G FG +F + + AV+ LAL A Y+AEIIR G++ Sbjct: 127 LLFWFNITYLYQTLSLGIPFGPEFFTFQVSGVIGGFTAAVIGLALHQAAYSAEIIRSGII 186 Query: 122 AVPVGQIEAGYSIGLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEVT 181 +V GQIEA +S+G+ +++ P A+R LP + E + L K T++ S + + E+ Sbjct: 187 SVDHGQIEAAHSLGIPRSRQFFKIVLPQAMRAILPNAANEVIGLFKGTSIVSTMAIAELF 246 Query: 182 GVAQQIIQQTYRTTEVFICAALIYLFLNFVIVRLLGMLETRLSRHLRAARPAAVSRPVSA 241 Q I + R + + A + Y+ ++ LL + + + RH AR +A + P++ Sbjct: 247 YQVQVIFGRNGRVVPLLMVATIWYI----ILTTLLSIGQYYVERHY--ARGSARALPLTP 300 Query: 242 TTEARR 247 +AR+ Sbjct: 301 VQKARK 306 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 324 Length adjustment: 26 Effective length of query: 224 Effective length of database: 298 Effective search space: 66752 Effective search space used: 66752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory