Align ABC transporter for L-Histidine, permease component (characterized)
to candidate WP_019745160.1 C1M55_RS24910 ABC transporter permease subunit
Query= reanno::pseudo5_N2C3_1:AO356_09615 (283 letters) >NCBI__GCF_002893965.1:WP_019745160.1 Length = 215 Score = 97.8 bits (242), Expect = 2e-25 Identities = 58/185 (31%), Positives = 100/185 (54%), Gaps = 4/185 (2%) Query: 96 LALMLVATLISVLIGIPLGILSARSNRLRSVLMPLLDIMQTMPSFVYLIPVLMLFGLGKV 155 ++ ++ + +I+ + + +GIL RS S+ L + T+PSF L ++ + GLG Sbjct: 23 VSAVIQSVIIATIAAVIIGILVYRSPAGSSIATALASTILTVPSFALLGLLIPILGLGVA 82 Query: 156 PAIFATVIYAAPPLIRLTDLGIRQVDGEVMEAINAFGANRWQQLFGVQLPLALPSIMAGI 215 P I A ++YA P+IR T +G+ V+ + +A G NR L ++LP+A PSI+ G+ Sbjct: 83 PTITALILYALLPIIRNTIIGLDAVNPAITDAARGVGMNRMHVLSRIELPIAWPSILTGM 142 Query: 216 NQTTMMALSMVVIASMIGARGLGEDVLVGIQTLN----VGRGLEAGLAIVILAVVIDRIT 271 +T M + ++ IA+ GLG + G+ + V + L + IVILA+++D I Sbjct: 143 RVSTQMLMGILAIAAYAKGPGLGNLIFSGLSRVGSPNAVPQALVGTVLIVILALILDGIY 202 Query: 272 QAYGR 276 GR Sbjct: 203 VVIGR 207 Lambda K H 0.328 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 215 Length adjustment: 24 Effective length of query: 259 Effective length of database: 191 Effective search space: 49469 Effective search space used: 49469 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory