Align 3-methyl-2-oxobutanoate dehydrogenase subunit beta; Branched-chain alpha-ketoacid dehydrogenase E1 component subunit beta; BCKADH E1-beta; EC 1.2.4.4 (characterized)
to candidate WP_050655237.1 C1M55_RS19775 alpha-ketoacid dehydrogenase subunit beta
Query= SwissProt::P9WIS1 (348 letters) >NCBI__GCF_002893965.1:WP_050655237.1 Length = 325 Score = 355 bits (912), Expect = e-103 Identities = 182/322 (56%), Positives = 231/322 (71%), Gaps = 4/322 (1%) Query: 26 LTMVQAINRALYDAMAADERVLVFGEDVAVEGGVFRVTEGLADTFGADRCFDTPLAESAI 85 + +V A+N L A+ D RV++ GEDV GGVFRVT+ L FG R D PLAES I Sbjct: 4 MNLVTALNTGLRRALEDDRRVVIMGEDVGRLGGVFRVTDALQKDFGDTRVIDMPLAESGI 63 Query: 86 IGIAVGLALRGFVPVPEIQFDGFSYPAFDQVVSHLAKYRTRTRGEVDMPVTVRIPSFGGI 145 +G A GLALRG+ PV EIQFDGF YPAFDQ+VS +AK + RTRG P+T+RIPS GGI Sbjct: 64 VGTAFGLALRGYRPVCEIQFDGFVYPAFDQIVSQVAKIQYRTRGAASAPLTIRIPSGGGI 123 Query: 146 GAAEHHSDSTESYWVHTAGLKVVVPSTPGDAYWLLRHAIACPDPVMYLEPKRRYHGRGMV 205 GA EHHS+S E+Y+ HTAGL+VV PS P D + ++R +IA DPV++LEPKRRY V Sbjct: 124 GAVEHHSESPEAYFAHTAGLRVVYPSNPIDGFHMIRQSIAGDDPVIFLEPKRRYWDTADV 183 Query: 206 DT-SRPEPPIGHAMVRRSGTDVTVVTYGNLVSTALSSADTAEQQ-HDWSLEVIDLRSLAP 263 DT + PE P+ A V R G D TVV YG++V+TAL +A AE++ HD LEV+DLRSL+P Sbjct: 184 DTDAAPELPLHRARVARPGDDATVVAYGSMVATALEAARIAEEEGHD--LEVVDLRSLSP 241 Query: 264 LDFDTIAASIQRTGRCVVMHEGPRSLGYGAGLAARIQEEMFYQLEAPVLRACGFDTPYPP 323 +DFDT+ AS+ +TGR VV+HE + LG GA +AA + E FYQLE+P+LR GFD PYPP Sbjct: 242 IDFDTVEASVNKTGRLVVVHEAQKFLGVGAEIAAHVAEHCFYQLESPILRVTGFDIPYPP 301 Query: 324 ARLEKLWLPGPDRLLDCVERVL 345 A+LE+ LP DR+L ++R L Sbjct: 302 AKLERFHLPDADRILAALDRTL 323 Lambda K H 0.321 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 325 Length adjustment: 28 Effective length of query: 320 Effective length of database: 297 Effective search space: 95040 Effective search space used: 95040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory