Align glucose 1-dehydrogenase (PQQ, quinone) (EC 1.1.5.2) (characterized)
to candidate WP_054188780.1 C1M55_RS21725 PQQ-dependent sugar dehydrogenase
Query= BRENDA::I7A144 (352 letters) >NCBI__GCF_002893965.1:WP_054188780.1 Length = 401 Score = 149 bits (376), Expect = 1e-40 Identities = 128/359 (35%), Positives = 177/359 (49%), Gaps = 49/359 (13%) Query: 21 LRVEEVVGGLEVPWALAFLPDGGMLIAERPGRIRLFREGRLST---YAELP-VYHRGESG 76 L V +V GL+ PW + PDG +L +R G R G +T A+L +Y + E+G Sbjct: 60 LSVTTLVDGLDHPWDVVAAPDGAILTGQRSGGF-FVRRGDNTTGPVAADLSDLYAQSETG 118 Query: 77 LLGLALHPRFPEAPYVYAYRTVAEGGLRN-QVVRLRHLGERGVLDRV--VLDGIPARPHG 133 L+G+AL F ++ +Y + + GG+ + +V+ L R VL GIP G Sbjct: 119 LMGIALARDFAQSRTLYTCQGFSAGGVTDVRVIAWTVDAGWTALTRTGTVLPGIPVSS-G 177 Query: 134 LHSGGRIAFGPDGMLYVTTGEVYERELAQDLASLGGKILRLTPEGEPAPGNPFLGRRGAR 193 H G RI DG L+V TG+ + QD SLGGK+L + +G PA GNP A Sbjct: 178 RHGGCRILAAQDGTLFVGTGDTATPSVPQDPNSLGGKVLHINADGTPAAGNP-----NAS 232 Query: 194 PEVYSLGHRNPQGLAWHPKTGELFSSEHGPSGEQGYGHDEVNLIVPGGNYGW--PRVVGR 251 VY+LGHRN QGLA P TG ++S E G S + DEVNL+ PGGNYG+ R+ G Sbjct: 233 SPVYTLGHRNVQGLAVQPGTGRVYSVEQGTSVD-----DEVNLLTPGGNYGYRPDRLPGT 287 Query: 252 GNDP-RYRDPL-------YFWPQG---FPPGNLAF--------FRGDLYVAGLRGQALLR 292 ++ DP+ W G + AF + G L + GL+ + L+ Sbjct: 288 YDESVPMTDPVRVPGAIAAVWRSGSSTLATASAAFTGGAAWGAWDGALVMGGLKSKELIF 347 Query: 293 LVLEGERGRWRVLRVETALSGFGRLREVQVGPDGALYVTTSNRDGRGQVRPGDDRVLRL 351 L L + GR + + FGRLR V PDG+L VTT N G D+VLR+ Sbjct: 348 LRLNAD-GRSVDAQTFGLENQFGRLRSVTPTPDGSLLVTTDNGAG--------DKVLRV 397 Lambda K H 0.322 0.146 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 34 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 401 Length adjustment: 30 Effective length of query: 322 Effective length of database: 371 Effective search space: 119462 Effective search space used: 119462 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory