Align Dihydrolipoyllysine-residue acyltransferase component of branched-chain alpha-ketoacid dehydrogenase complex; Branched-chain alpha-ketoacid dehydrogenase complex component E2; BCKADH E2; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; EC 2.3.1.168 (characterized)
to candidate WP_050655236.1 C1M55_RS19780 2-oxo acid dehydrogenase subunit E2
Query= SwissProt::O06159 (393 letters) >NCBI__GCF_002893965.1:WP_050655236.1 Length = 402 Score = 214 bits (545), Expect = 4e-60 Identities = 144/401 (35%), Positives = 203/401 (50%), Gaps = 22/401 (5%) Query: 10 FPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGRIVELGGAEG 69 F +PDLGEGL + W+V VGD V +NQ L VETAKA VE+PSPY G + EL G Sbjct: 7 FRLPDLGEGLTSADLVEWAVGVGDTVALNQVLAQVETAKALVELPSPYVGVVRELLVEPG 66 Query: 70 DVLKVGAELVRIDTGPTAVAQPNGEGAVPTLVGYGADTAIETSRR------------TSR 117 + VG ++RI+ + + N + LVGYG T + RR T R Sbjct: 67 TTVPVGTPIIRIEESSNSPSPSNSQSP-SVLVGYGPATERPSRRRSKITPYSQSAASTER 125 Query: 118 PLAAPVVRKLAKELAVDLAALQRGSGAGGVITRADVLAAARGGVGAGPDVRPVH-GVHAR 176 A P R+ A+E +DL+ + GSG G +T ADV A + R G+ + Sbjct: 126 RPATPAARRAAREAGIDLSEIT-GSGFDGAVTAADVADALTVQSPSDNATRLASSGIRKQ 184 Query: 177 MAEKMTLSHKEIPTAK----ASVEVICAELLRLRDRFVSAAPEITPFALTLRLLVIALKH 232 MA M S + P A A V L RLR +TP L + +V A+ Sbjct: 185 MASAMVASTRA-PQASVFLTADVTPSMELLGRLRSSEAFTGLSLTPLTLAAKAMVAAIAS 243 Query: 233 NVILNSTWVDSGEGPQVHVHRGVHLGFGAATERGLLVPVVTDAQDKNTRELASRVAELIT 292 + ++N+ W D G V V+LG A+ERGL VP + A+ + +LA V EL Sbjct: 244 HPMVNAHW-DEARGDAA-VDDDVNLGIAVASERGLSVPNIKSAETLSLVQLARAVTELTV 301 Query: 293 GAREGTLTPAELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLGAIKPRPVVVGGEVVA 352 AREG L G T T++N G GVD G+P++N EA IL LG++ RP V+ ++ Sbjct: 302 AAREGKTDVRHLTGGTVTITNVGVFGVDGGIPLLNPGEAVILCLGSVSERPWVIERKIEV 361 Query: 353 RPTMTLTCVFDHRVVDGAQVAQFMCELRDLIESPETALLDL 393 R +TLT FDHRV+ G + A+F+ + +++ +P+ L L Sbjct: 362 RSVVTLTLTFDHRVLTGERAARFLSFVAEMLANPDLLLTHL 402 Lambda K H 0.317 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 402 Length adjustment: 31 Effective length of query: 362 Effective length of database: 371 Effective search space: 134302 Effective search space used: 134302 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory