Align Putative acyl-CoA dehydrogenase AidB; EC 1.3.99.- (characterized)
to candidate WP_050655941.1 C1M55_RS30290 acyl-CoA dehydrogenase
Query= SwissProt::P33224 (541 letters) >NCBI__GCF_002893965.1:WP_050655941.1 Length = 563 Score = 382 bits (981), Expect = e-110 Identities = 215/479 (44%), Positives = 280/479 (58%), Gaps = 11/479 (2%) Query: 4 QTHTVFNQPIPLNNSNLYLSDGALCEAVTREGAGWDSDFLASIGQQLGTAESLELGRLAN 63 +TH V NQ +P + N +L D L E V R A W + L IG+ +G+A LAN Sbjct: 16 RTHAVLNQSVPRTDVNEFLLDTVLAEGVARHDADWATSELTDIGELVGSAGFQHDAELAN 75 Query: 64 VNPPELLRYDAQGRRLDDVRFHPAWHLLMQALCTNRVHNLAWEEDARSGAFVARAARFML 123 PEL +D G R+D+V +HP++H ++ A + H AW D + GA VARAA FML Sbjct: 76 TVIPELKTFDRWGNRIDEVEYHPSYHRIISAAVAHGAHTSAWA-DPKPGANVARAAAFML 134 Query: 124 HAQVEAGSLCPITMTFAATPLLLQMLPAPFQDWTTPLLSDRYDSHLLPGGQKRGLLIGMG 183 +QVE G CPI+MT A P L ++ P WT LS Y L G K + GM Sbjct: 135 FSQVEPGHACPISMTHAVIPSL-ELQPDVAAIWTPRALSRSYTPELDAPG-KASAIFGMS 192 Query: 184 MTEKQGGSDVMSNTTRAERLEDGS----YRLVGHKWFFSVPQSDAHLVLAQTAG----GL 235 MTEKQGGSDV +NTT A+ G Y L GHKWF S P SDA LVLAQ G GL Sbjct: 193 MTEKQGGSDVRANTTIAKPAGRGGPGADYLLTGHKWFCSAPMSDAFLVLAQAEGAAGEGL 252 Query: 236 SCFFVPRFLPDGQRNAIRLERLKDKLGNRSNASCEVEFQDAIGWLLGLEGEGIRLILKMG 295 SCF +PR LPDG RN R++RLK+KLGN+SNAS E+E +G ++G G G+R I++M Sbjct: 253 SCFLLPRILPDGTRNVFRIQRLKNKLGNKSNASSEIELDGTVGTMIGEPGRGVRTIIEMV 312 Query: 296 GMTRFDCALGSHAMMRRAFSLAIYHAHQRHVFGNPLIQQPLMRHVLSRMALQLEGQTALL 355 TR DC LGS A MR++ + A++HA R FG L QP M VL+ +AL+ E T Sbjct: 313 SQTRLDCILGSTAGMRQSVAEAVWHARHRSAFGAVLADQPAMTSVLADLALESEAATITA 372 Query: 356 FRLARAWDRRADAKEALWARLFTPAAKFVICKRGMPFVAEAMEVLGGIGYCEESELPRLY 415 RLARA D A+ +E + RL T AK+ ICKRG EA+E LGG GY E+ L R Y Sbjct: 373 LRLARAQDEDANEQEKAFRRLATAVAKYWICKRGPHHSYEALECLGGNGYTEDFPLARRY 432 Query: 416 REMPVNSIWEGSGNIMCLDVLRVLNKQAGVYDLLSEAFVEVKGQDRYFDRAVRRLQQQL 474 RE PV ++WEGSGN++ LDVLR + ++ +G + D+ + R+++QL Sbjct: 433 REQPVMAVWEGSGNVIALDVLRAMTREPDSVAAFDHEINLARGNNPVLDQHLDRVRRQL 491 Lambda K H 0.324 0.138 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 628 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 541 Length of database: 563 Length adjustment: 36 Effective length of query: 505 Effective length of database: 527 Effective search space: 266135 Effective search space used: 266135 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory