Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate WP_003939784.1 C1M55_RS25280 acyl-CoA dehydrogenase
Query= BRENDA::Q18AQ1 (378 letters) >NCBI__GCF_002893965.1:WP_003939784.1 Length = 385 Score = 343 bits (880), Expect = 5e-99 Identities = 184/375 (49%), Positives = 252/375 (67%), Gaps = 3/375 (0%) Query: 5 SKKYQMLKELYVSFAENEVKPLATELDEEERFPYETVEKMAKAGMMGIPYPKEYGGEGGD 64 ++++ L+ +E E+ P A ++DE RFP E + + +G I P+ Y G+G D Sbjct: 13 NEEHDELRAAIRGLSEKEIAPYAKDVDENARFPEEALTALNASGFNAIHVPEAYDGQGAD 72 Query: 65 TVGYIMAVEELSRVCGTTGVILSAHTSLGSWPIYQYGNEEQKQKFLRPLASGEKLGAFGL 124 +V + +EE++RVCG++ +I A LG+ + G+EE K K L L +G + ++ L Sbjct: 73 SVATCIVIEEVARVCGSSSLI-PAVNKLGTMGLILKGSEELKSKVLPDLVNGG-MASYAL 130 Query: 125 TEPNAGTDASGQQTTAVLDGDEYILNGSKIFITNAIAGDIYVVMAMTDKSKGNKGISAFI 184 +E AG+DA+ +T A DGD++ILNGSK +ITN Y VMA+TD KG GIS+F+ Sbjct: 131 SEREAGSDAASMRTRAKADGDDWILNGSKCWITNGGKSTWYTVMAVTDPDKGANGISSFM 190 Query: 185 VEKGTPGFSFGVKEKKMGIRGSATSELIFEDCRIPKENLLGKEGQGFKIAMSTLDGGRIG 244 V K GF G KEKK+GI+GS T+EL FE+CRIP + ++G+ G GFK A+ TLD R Sbjct: 191 VHKDDEGFVVGPKEKKLGIKGSPTAELYFENCRIPGDRIIGEPGTGFKTALETLDHTRPT 250 Query: 245 IAAQALGLAQGALDETVKYVKERVQFGRPLSKFQNTQFQLADMEVKVQAARHLVYQAAIN 304 I AQA+GLAQGALD + Y K+R QFG+ +S FQ QF LADM +KV+AAR +VY +A Sbjct: 251 IGAQAVGLAQGALDAALAYTKDRKQFGKSISDFQAVQFMLADMAMKVEAARLMVYTSAAR 310 Query: 305 KDLG-KPYGVEAAMAKLFAAETAMEVTTKAVQLHGGYGYTRDYPVERMMRDAKITEIYEG 363 + G K G +A AK FA++ AMEVTT AVQL GG GYT D+PVERMMRDAKIT+IYEG Sbjct: 311 AERGEKNLGFISAAAKCFASDVAMEVTTDAVQLFGGAGYTTDFPVERMMRDAKITQIYEG 370 Query: 364 TSEVQRMVISGKLLK 378 T+++QR+V+S LLK Sbjct: 371 TNQIQRVVMSRALLK 385 Lambda K H 0.315 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 385 Length adjustment: 30 Effective length of query: 348 Effective length of database: 355 Effective search space: 123540 Effective search space used: 123540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory