Align Maltose/Maltotriose PTS transporter, MalT (Shelburne et al., 2008) 631aas (68% identical to 4.A.1.1.11 from S. mutans (characterized)
to candidate WP_003941307.1 C1M55_RS19660 PTS transporter subunit EIIC
Query= TCDB::Q48WG5 (631 letters) >NCBI__GCF_002893965.1:WP_003941307.1 Length = 447 Score = 139 bits (349), Expect = 3e-37 Identities = 95/310 (30%), Positives = 149/310 (48%), Gaps = 40/310 (12%) Query: 47 LNTGVFVGIIAGFVGATAYNKYYNYRKLPEVLTFFNGKRFVPFVVILRSIFVALILVVVW 106 +N GV GI+ G + A + ++Y KLP+ L FFNG+R VP + + + V +++ V+ Sbjct: 126 INYGVLAGIVMGLLSAILWQRFYR-TKLPDYLGFFNGRRLVPILTAITGLVVGVLMAFVY 184 Query: 107 PVIQSGINSFGMWIASSQDSAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEV 166 P+ SG+N W+ + S ++ +YG RLL+P GLHH+L + + L G Y+ Sbjct: 185 PLFNSGLN----WVGEAVASNTVVGGGIYGAANRLLIPTGLHHILNSAVWF--LIGDYQ- 237 Query: 167 MTGAAAGTKVFGQDPLWLAWVTDLVHLKGSDASAYSHLMDSVTPARFKVGQMIGATGTLM 226 A+G V G DL D SA F G L Sbjct: 238 ---DASGQIVRG----------DLNRFFAGDPSA----------GTFMTGFFPIMMFALP 274 Query: 227 GVALAMYRNVDADKKHTYKMMFISAAAAVFLTGVTEPLEYLFMFAAMPLYIVYALVQGAS 286 A A++RN +K + +S FLTG+TEPLE+ FMF A PLY++++L+ G S Sbjct: 275 AAAFAIWRNAKPSQKKLVGGIMLSTGLTAFLTGITEPLEFSFMFVAWPLYVIHSLLTGTS 334 Query: 287 FAMADLVNLR---VHSFGNIELLTRTPMALKAGLGMDVINFVWVSVLFAVIMYFIADMMI 343 A+ + + + S G + + L G + + + + +AVI YF+ +I Sbjct: 335 MALVNALGIHDGFTFSAGFFDYV------LNFGKATNAWMLIPIGLGYAVIYYFLFSFVI 388 Query: 344 KKMHLATAGR 353 KK +L T GR Sbjct: 389 KKWNLRTPGR 398 Lambda K H 0.322 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 639 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 631 Length of database: 447 Length adjustment: 35 Effective length of query: 596 Effective length of database: 412 Effective search space: 245552 Effective search space used: 245552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory