Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate WP_050655237.1 C1M55_RS19775 alpha-ketoacid dehydrogenase subunit beta
Query= uniprot:G1UHX5 (328 letters) >NCBI__GCF_002893965.1:WP_050655237.1 Length = 325 Score = 369 bits (948), Expect = e-107 Identities = 188/321 (58%), Positives = 227/321 (70%), Gaps = 5/321 (1%) Query: 1 MSEITMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAE 60 M+ + + ALNT LR AL DD R ++ GED+G LGGVFR+TD L +FGD R D PLAE Sbjct: 1 MTVMNLVTALNTGLRRALEDDRRVVIMGEDVGRLGGVFRVTDALQKDFGDTRVIDMPLAE 60 Query: 61 SAILGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYG 120 S I+GTA G+A+ GYRPV E+QFD F YPAF+Q+VS VAK++ RTRGA PLTIRIP G Sbjct: 61 SGIVGTAFGLALRGYRPVCEIQFDGFVYPAFDQIVSQVAKIQYRTRGAASAPLTIRIPSG 120 Query: 121 GGIGGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYWRK 180 GGIG VEHHS+S E Y+ T GL VV P+ D + ++R+SIA DPV+FLEPKR YW Sbjct: 121 GGIGAVEHHSESPEAYFAHTAGLRVVYPSNPIDGFHMIRQSIAGDDPVIFLEPKRRYW-- 178 Query: 181 EALGLPVDTG---PLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRT 237 + + D PL A + R G AT++AYG V TALEAA A E G DLEV+DLR+ Sbjct: 179 DTADVDTDAAPELPLHRARVARPGDDATVVAYGSMVATALEAARIAEEEGHDLEVVDLRS 238 Query: 238 LMPLDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVP 297 L P+D TV ASV +TGR VVVHEA F G GAEIAA + E CFY LE+P+ RVTGFD+P Sbjct: 239 LSPIDFDTVEASVNKTGRLVVVHEAQKFLGVGAEIAAHVAEHCFYQLESPILRVTGFDIP 298 Query: 298 YPPPLLERHYLPGVDRILDAV 318 YPP LER +LP DRIL A+ Sbjct: 299 YPPAKLERFHLPDADRILAAL 319 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 325 Length adjustment: 28 Effective length of query: 300 Effective length of database: 297 Effective search space: 89100 Effective search space used: 89100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory