Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate WP_085989936.1 C1M55_RS23130 alpha-ketoacid dehydrogenase subunit beta
Query= uniprot:G1UHX5 (328 letters) >NCBI__GCF_002893965.1:WP_085989936.1 Length = 341 Score = 201 bits (510), Expect = 3e-56 Identities = 128/338 (37%), Positives = 171/338 (50%), Gaps = 17/338 (5%) Query: 1 MSEITMAKALNTALRDALRDDPRTILFGED----------------IGALGGVFRITDGL 44 MS+ T +A+ A+ ++ DP +L GED I A GGV +T GL Sbjct: 1 MSKKTYREAVKEAIAQEMQRDPSVVLIGEDVRGGHAGTNPDLETKKIEAFGGVLGVTKGL 60 Query: 45 AAEFGDERCFDTPLAESAILGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNR 104 EFG ER DTP+ ESAI+G A G A+ G RPV E+ F F +++ L + AK R Sbjct: 61 WTEFGSERVIDTPITESAIIGMAAGAALTGLRPVAELMFMDFFGVSYDALYNQAAKFRYM 120 Query: 105 TRGAIGLPLTIRIPYGGGIGGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIAS 164 G PL +R G G HS S + A PGL VV P+ A DA LL ++I Sbjct: 121 FGGKARTPLVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVAPSNAYDAKGLLIQAIRD 180 Query: 165 PDPVVFLEPKRLYWRKEALGLPVDTGPLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAA 224 DPVVF E K LY K+ + P G A R G T+IA V A + A+ A Sbjct: 181 DDPVVFCEHKVLYDLKDEVPDEPYAIPFGVANYTRQGDDVTIIALSAMVNRANDVADKLA 240 Query: 225 EHGWDLEVIDLRTLMPLDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHL 284 G +EV+D RT+ PLD+ + SV TGR V+V E+ G G ++AA I + F +L Sbjct: 241 AEGISVEVVDPRTVSPLDEDGILESVASTGRVVIVDESAARCGFGHDVAALIATKGFNYL 300 Query: 285 EAPVRRVTGFDVPYP-PPLLERHYLPGVDRILDAVASL 321 +AP+ +T P P P LE +LP RI ++V L Sbjct: 301 KAPIELITPPHTPVPFSPTLETAWLPDAARIEESVRKL 338 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 341 Length adjustment: 28 Effective length of query: 300 Effective length of database: 313 Effective search space: 93900 Effective search space used: 93900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory