Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_003944195.1 C1M55_RS00710 SDR family NAD(P)-dependent oxidoreductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_002893965.1:WP_003944195.1 Length = 255 Score = 243 bits (620), Expect = 3e-69 Identities = 135/259 (52%), Positives = 175/259 (67%), Gaps = 12/259 (4%) Query: 8 VKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNC----VFAPA 63 +KG A++TG ASGLG ATA+RL GA+ LDLP A ++ G+N P Sbjct: 3 IKGTAALVTGAASGLGAATAKRLADAGATVFGLDLP-----ASIERAGDNVPAGVTLIPT 57 Query: 64 DVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLM 123 DVTS ++V+ A+ + + VNCAG+ A + + KKG H LE F+ V+ VNL+ Sbjct: 58 DVTSGEEVEAAINQIVESGSPLRIVVNCAGVGWAGRILS-KKGP-HDLELFRTVITVNLL 115 Query: 124 GTFNVIRLVAGEMGQNEP-DQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPI 182 GTFNV+RL A + + E D+ GQRGV+INTASVAAFEGQ+GQ AYSASKGG+ GMT+P Sbjct: 116 GTFNVMRLAADAIAKTEAVDESGQRGVVINTASVAAFEGQIGQIAYSASKGGVHGMTVPA 175 Query: 183 ARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIE 242 ARDLA GIRV TIAPG+ TP+L + ++ L + VPFPSRLG P+EYA L Q I+E Sbjct: 176 ARDLAQFGIRVNTIAPGIIDTPMLAGVTDEYRKGLEAGVPFPSRLGQPSEYAQLAQMIVE 235 Query: 243 NPFLNGEVIRLDGAIRMQP 261 + +LNGE IR+DGA+RM P Sbjct: 236 HDYLNGETIRMDGALRMAP 254 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 255 Length adjustment: 24 Effective length of query: 237 Effective length of database: 231 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory