Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_003939931.1 C1M55_RS22595 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_002893965.1:WP_003939931.1 Length = 237 Score = 199 bits (506), Expect = 4e-56 Identities = 102/237 (43%), Positives = 158/237 (66%), Gaps = 5/237 (2%) Query: 4 NILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGH 63 ++L V L YG + G+ L+V G + ++GANGAGKTT ++A+ G +P +G Sbjct: 2 SLLSVDDLHAGYGRGNVLHGVSLDVEPGGVAVVLGANGAGKTTMMRALAGLIPH---QGT 58 Query: 64 IEYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAADIDKW 123 I + G PL G K V +++VP+GRG ++S+++NLL+GA +DK +I ADI++W Sbjct: 59 ITFNGSPL-GSKPERAVAAGVSLVPQGRGTLGQLSVRDNLLVGAALRNDKAEIEADIERW 117 Query: 124 FAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVI 183 FP L R+ Q+AG+LSGGEQQMLA+ARALMS P LLL DEPS+GL+PI++ ++F+ + Sbjct: 118 CETFPVLARRSTQLAGSLSGGEQQMLAVARALMSRPTLLLCDEPSLGLAPIVIAELFDTL 177 Query: 184 RNVS-AQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKAAYLG 239 ++ + G +L+VEQNA LA++ A + ++++ G I G ++ D V++AYLG Sbjct: 178 GAINRSDGTALLIVEQNADLAMKLASKVFLLDVGTIVAAGTPEEFRSDDVVRSAYLG 234 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 237 Length adjustment: 23 Effective length of query: 218 Effective length of database: 214 Effective search space: 46652 Effective search space used: 46652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory