Align HutW aka HISW, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_019745160.1 C1M55_RS24910 ABC transporter permease subunit
Query= TCDB::Q9KKE2 (285 letters) >NCBI__GCF_002893965.1:WP_019745160.1 Length = 215 Score = 97.1 bits (240), Expect = 3e-25 Identities = 57/188 (30%), Positives = 103/188 (54%), Gaps = 4/188 (2%) Query: 96 LALMLMATIVSVVIGVPMGILVAKSRVVRNITLPVLDVMQTMPSFVYLIPALMLFGLGKV 155 ++ ++ + I++ + V +GILV +S +I + + T+PSF L + + GLG Sbjct: 23 VSAVIQSVIIATIAAVIIGILVYRSPAGSSIATALASTILTVPSFALLGLLIPILGLGVA 82 Query: 156 PAILATIIYAVPPLIRLTDLGIRQVDAEVVEAATAFGGSPGQILFGVELPLATPTIMAGL 215 P I A I+YA+ P+IR T +G+ V+ + +AA G + +L +ELP+A P+I+ G+ Sbjct: 83 PTITALILYALLPIIRNTIIGLDAVNPAITDAARGVGMNRMHVLSRIELPIAWPSILTGM 142 Query: 216 NQTIMMALSMVVVASMIGARGLGEQVLNGIQTLD----VGKGLEAGIGIVILAVVLDRIT 271 + M + ++ +A+ GLG + +G+ + V + L + IVILA++LD I Sbjct: 143 RVSTQMLMGILAIAAYAKGPGLGNLIFSGLSRVGSPNAVPQALVGTVLIVILALILDGIY 202 Query: 272 QGFGKPRT 279 G+ T Sbjct: 203 VVIGRLTT 210 Lambda K H 0.327 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 215 Length adjustment: 24 Effective length of query: 261 Effective length of database: 191 Effective search space: 49851 Effective search space used: 49851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory