Align BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized)
to candidate WP_003940114.1 C1M55_RS25960 ATP-binding cassette domain-containing protein
Query= TCDB::Q93A35 (328 letters) >NCBI__GCF_002893965.1:WP_003940114.1 Length = 371 Score = 229 bits (583), Expect = 1e-64 Identities = 138/315 (43%), Positives = 189/315 (60%), Gaps = 28/315 (8%) Query: 1 MIRFDNVSKKYSDDKTAAVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTTGTI 60 MI+FD V+K Y D T AV+ + L+ G+ +GPSGCGKTT+L+MINRLI T+GTI Sbjct: 1 MIKFDKVTKAYPDG-TIAVDALDLECPTGKITALVGPSGCGKTTSLRMINRLIEPTSGTI 59 Query: 61 YINEKRISDYDIHELRWDIGYVLQQIALFPHMTIEENIAIVPELKKWSKEKIHDRITELL 120 ++ + + D LR IGYV+Q LFPH TI +NIA +P L SK++ R ELL Sbjct: 60 SLDGESTAGMDPALLRRRIGYVIQHAGLFPHRTIVDNIATMPRLLGASKKESRTRAMELL 119 Query: 121 DSVGLDPESYRHRKPAELSGGEQQRVGVVRALAADPGIILMDEPFSALDPISRQRLQQDI 180 ++VGL ++ R P +LSGG+QQRVGV RALAADP +LMDEPFSA+DP+ R +LQ + Sbjct: 120 ETVGLTT-NFADRYPWQLSGGQQQRVGVARALAADPSFMLMDEPFSAVDPVVRGQLQDEF 178 Query: 181 SALQKKIKKTIVFVTHDMQEALALGDRICVMQ-GGEIVQVATPQEIMKNPENDFVKDFLA 239 LQK+I KTI+ VTHD+ EAL LGD++ V++ GG + Q ATP E++ P ++FV DF+ Sbjct: 179 LRLQKEIGKTIIIVTHDIDEALKLGDQVVVLRTGGILAQAATPLELLTQPADEFVADFVG 238 Query: 240 SGHAFNTPILEANFTVNDLIEADLFYSYQTSDGTLGISSTEPVENL------VRRIAEEQ 293 + + + T DG L S EPV +L R + + Sbjct: 239 RDRGYRS------------------LGFTTLDGDLPTVS-EPVAHLGDSAAAARALTGDT 279 Query: 294 SIPVTDEAGNYIGTV 308 + V D A +G V Sbjct: 280 WLLVVDPANKPLGWV 294 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 371 Length adjustment: 29 Effective length of query: 299 Effective length of database: 342 Effective search space: 102258 Effective search space used: 102258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory