Align Serine transporter, SerP2 or YdgB, of 459 aas and 12 TMSs (Trip et al. 2013). Transports L-alanine (Km = 20 μM), D-alanine (Km = 38 μM), L-serine, D-serine (Km = 356 μM) and glycine (Noens and Lolkema 2015). The encoding gene is adjacent to the one encoding SerP1 (TC# 2.A.3.1.21) (characterized)
to candidate WP_021333985.1 C1M55_RS07700 amino acid permease
Query= TCDB::F2HQ24 (457 letters) >NCBI__GCF_002893965.1:WP_021333985.1 Length = 463 Score = 278 bits (711), Expect = 3e-79 Identities = 158/450 (35%), Positives = 252/450 (56%), Gaps = 13/450 (2%) Query: 13 QRGLKNRHIQLIAIAGTIGTGLFLGAGKSIHLTGPSIIFVYLIIGALMYILLRAIGEMLY 72 +RGL RHI+ IA+ IGTGLF G+ ++I GPS++ YLI G +Y++LRA+GEM Sbjct: 12 KRGLTARHIRFIALGSAIGTGLFYGSAEAIKRAGPSVLLAYLIGGIAVYLVLRALGEMAV 71 Query: 73 QDPNQHSFLNFVSRYLGEKPGYFIQWSYLLVVVFVAMAELIAIGTYINFWLPDLPIWMTE 132 ++P SF + +++LG G+ W+Y +V V +A++ A G Y+ FW PD+P W+ Sbjct: 72 RNPVSGSFSEYANKHLGPLAGFMTGWTYTFEMVIVCLADVTAFGLYMQFWFPDVPRWIWV 131 Query: 133 VFVLVLLTLLNTLNPKFFGETEFWFGMIKIVAIIGLILTAIILIFSHYHTGTDTVSVTNI 192 + V+ + +N L+ K FGE EFWF ++KI AII +I I +I + ++++ Sbjct: 132 LAVVFFIGAINLLSVKVFGELEFWFTLVKITAIIAMIAGGIAIIVFGFGVHDTDAGISHL 191 Query: 193 TKGFEFFPNGLSNFFESFQMVMFAFVSMEFIGMTAAETDNPRPTLKKAINQIPIRIVLFY 252 FF G F F +VMFAF E IG+TA E ++P T++KA+N +P+RI+LFY Sbjct: 192 WSDGGFFATGFGGFVACFAIVMFAFGGTEIIGITAGEAEDPAQTIRKAVNTVPVRIILFY 251 Query: 253 VGALLAIMSIYQWRDIPADKSPFVTIFQLIGIKWAAALVNFVVLTSAASALNSALFSITR 312 + L IM+I W+ I +D SPFV IF+ +G+ AA+++N VV+T+A SA+NS +F R Sbjct: 252 ICTLAVIMAIIPWQTINSDNSPFVQIFENLGLGTAASILNIVVITAALSAINSDVFGAGR 311 Query: 313 NLYSLSKLNN-DKILKPFTKFSKAGVP-VNALLFTSLLILFTPFISMIPAISNSFVFITS 370 ++ +S +++K + S GVP + ++ T L++ +IP F+ I S Sbjct: 312 MMFGMSHAGQAPQVMK---RVSANGVPWMTVVIMTVALLVGVVLNYLIP--DQVFLVIAS 366 Query: 371 VATNLFLVVYLMTLITYLKYRKSSDFDPKG---FVLPAAHIFIPLAIAGFVLIFISLFCF 427 +AT + V++M L++ + R D F +P AI + + L Sbjct: 367 LATFATIFVWIMILLSQFRSRAQMSADETAALKFPVPLWPYGQIFAIVFLAFVIVLLGVI 426 Query: 428 KDTIVPAIGSVIW-VLIFGLFTFFKKIKTA 456 DT V + W VL+ G ++K +K A Sbjct: 427 ADTRVALLVGAGWLVLLTG--AYYKWVKPA 454 Lambda K H 0.330 0.144 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 540 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 463 Length adjustment: 33 Effective length of query: 424 Effective length of database: 430 Effective search space: 182320 Effective search space used: 182320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory