Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_050656200.1 C1M55_RS20455 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_002893965.1:WP_050656200.1 Length = 389 Score = 306 bits (784), Expect = 6e-88 Identities = 178/382 (46%), Positives = 235/382 (61%), Gaps = 30/382 (7%) Query: 1 MTGLLLKDIRKSY-GAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGD 59 M ++L + K Y + +D+ I +GEF++ VGPSGCGKST L MIAGLE+I+ G+ Sbjct: 1 MAEIVLDKVTKLYPDGAKAVSDVDITIADGEFIILVGPSGCGKSTTLNMIAGLEDISTGE 60 Query: 60 MFIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAAD 119 + I GERVN+ P R IAMVFQSYALYPHMTV N+AF + +A+ SK+EI+ +V AA Sbjct: 61 LRIAGERVNERAPKDRDIAMVFQSYALYPHMTVRQNIAFPLTLAKMSKDEINAKVDDAAR 120 Query: 120 MLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKL 179 +L LT +LDR P LSGGQRQRVA+GRAI R+PK FL DEPLSNLDA LRV R EIA+L Sbjct: 121 VLDLTQHLDRKPANLSGGQRQRVAMGRAIVRSPKAFLMDEPLSNLDAKLRVQMRTEIARL 180 Query: 180 SERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPA 239 +R+ TT IYVTHDQ EAMTL DR+VVL G ++Q+GAP ELY+RP NLFVA FIGSP+ Sbjct: 181 QQRLG-TTTIYVTHDQTEAMTLGDRVVVLRGGIVQQIGAPQELYDRPNNLFVAGFIGSPS 239 Query: 240 MNVIPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRP---EDLRVTEADDF 296 MN P +TA G T + + S +GK G+RP ED+ + +A Sbjct: 240 MNFFPGQLTADGVSTPIGDV-RLPAAAQSKISGSGSGKDVVVGIRPEHFEDVALVDAAQK 298 Query: 297 LFEGT----VSIVEALGEVTLLY------------IEGLVENE--------PIIAKMPGI 332 GT V ++E++G Y +E L + ++A++ Sbjct: 299 PHGGTFTVDVDVLESMGSDKYAYFLAGGPAVNSRELEELAADSGTAVAGGGQLVARLSSE 358 Query: 333 ARVGRGDKVRFTADKAKLHLFD 354 + V +G + D AK+ +FD Sbjct: 359 STVAKGRSIDLWFDPAKIAVFD 380 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 389 Length adjustment: 30 Effective length of query: 332 Effective length of database: 359 Effective search space: 119188 Effective search space used: 119188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory