GapMind for catabolism of small carbon sources

 

Alignments for a candidate for fruII-A in Rhodococcus qingshengii djl-6-2

Align Sugar hosphotransferase system IIA component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized)
to candidate WP_050655799.1 C1M55_RS13985 PTS transporter subunit EIIA

Query= TCDB::Q5V5X4
         (158 letters)



>NCBI__GCF_002893965.1:WP_050655799.1
          Length = 689

 Score = 96.7 bits (239), Expect = 7e-25
 Identities = 62/141 (43%), Positives = 82/141 (58%), Gaps = 6/141 (4%)

Query: 12  ELIPANHISL-SEPPAEKEACIESLLDLLVDSGRVEDRDRALEALLERESETTTGVGMGI 70
           E+I    ISL ++  + KE  I SL   L  +GR  D    ++A L RE+++ TG+  GI
Sbjct: 13  EIISPELISLDTDLGSTKEDVIRSLAARLTAAGRASDAAGLVDAALAREAQSATGLPGGI 72

Query: 71  GIPHAKTDAVSRPSLAFARSQEGVDFGSMDGEPATLVFMILVPEAGGEEHLNILSSLSRA 130
            IPH + +AVS  SL FAR    VDFG+ DG PA LVF+I  PE  G EH+ +LSSL+RA
Sbjct: 73  AIPHCRAEAVSSASLGFARLDPKVDFGAPDG-PADLVFLIAAPEGAGAEHMKLLSSLARA 131

Query: 131 LMHDDVRDRLHAAADEATVQD 151
           L    VR     +  EA+  D
Sbjct: 132 L----VRPAFVTSLREASTPD 148


Lambda     K      H
   0.314    0.131    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 253
Number of extensions: 12
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 158
Length of database: 689
Length adjustment: 28
Effective length of query: 130
Effective length of database: 661
Effective search space:    85930
Effective search space used:    85930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory