Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate WP_003946415.1 C1M55_RS22115 UTP--glucose-1-phosphate uridylyltransferase
Query= BRENDA::O05576 (306 letters) >NCBI__GCF_002893965.1:WP_003946415.1 Length = 303 Score = 449 bits (1155), Expect = e-131 Identities = 226/291 (77%), Positives = 256/291 (87%), Gaps = 3/291 (1%) Query: 11 TAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAAAGAERLVIVTSEGKDGVV 70 TA+VPAAGLGTRFLPATKTVPKELLPVVDTPGIELVA EAA +GAERLVIVTS GKDGVV Sbjct: 14 TAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAGEAADSGAERLVIVTSPGKDGVV 73 Query: 71 AHFVEDLVLEGTLEARGKIAMLAKVRRAPALIKVESVVQAEPLGLGHAIGCVEPTLSPDE 130 AHFVEDLVLE LEA GK+A LAKVR+AP L++V+SV+Q +PLGLGHA+GCVE L DE Sbjct: 74 AHFVEDLVLESKLEASGKLAALAKVRKAPGLLEVDSVIQEQPLGLGHAVGCVESVLDDDE 133 Query: 131 DAVAVLLPDDLVLPTGVLETMSKVRASRGGTVLCAIEVAREEISAYGVFDVEPVPDGDYT 190 DA+AVLLPDDLVLP GVLE M++VRA RGG+VLCAI+V ++ +SAYGVFDVE VPD Sbjct: 134 DAIAVLLPDDLVLPRGVLEIMARVRAKRGGSVLCAIDVPKDAVSAYGVFDVEIVPD---A 190 Query: 191 DDPNVLKVRGMVEKPKAETAPSRYAAAGRYVLDRAIFDALRRIDQGAGGEVQLTDAIALL 250 +P+VLKV GMVEKP E APS +AAAGRY+LDRAIFDALRRI+ GAGGE+QLTDAIALL Sbjct: 191 VNPDVLKVVGMVEKPAVEDAPSTFAAAGRYLLDRAIFDALRRIEPGAGGELQLTDAIALL 250 Query: 251 IAEGHPVHVVVHQGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVARL 301 I+EGHPVHVVVH+G+RHDLGNPGGYL+A+VD ALD DDYGP LR+WL RL Sbjct: 251 ISEGHPVHVVVHRGTRHDLGNPGGYLRASVDLALDSDDYGPSLRKWLADRL 301 Lambda K H 0.318 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 303 Length adjustment: 27 Effective length of query: 279 Effective length of database: 276 Effective search space: 77004 Effective search space used: 77004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory