Align glucose transporter, ATPase component (characterized)
to candidate WP_076948807.1 C1M55_RS07375 amino acid ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_002893965.1:WP_076948807.1 Length = 261 Score = 101 bits (252), Expect = 1e-26 Identities = 73/229 (31%), Positives = 116/229 (50%), Gaps = 17/229 (7%) Query: 16 VEMKDISISFGGIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMDAGEIRVN 75 VE + I SFG ++ + V + + GEV +LG +G+GKSTL++ L+ ++D G +R++ Sbjct: 13 VEARGIHKSFGTLEVLAGVDLLVRKGEVTVILGPSGSGKSTLLRTLNHLEKVDRGTVRID 72 Query: 76 GDKV-------EITNPRDA-----RSHNIETIYQTLALADNLDAASNLFLGRELVTPFGL 123 G+ + + RD RSH I ++Q L +L A N+ E Sbjct: 73 GELIGYRRKGNRLHELRDREILKQRSH-IGFVFQNFNLFPHLTALENVV---EAPLSAQK 128 Query: 124 VDDSAMEAECRKIMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAA 183 D + E R ++ R+ +K E LSGGQ+Q VAIARA+ +++ DEPT+A Sbjct: 129 RDRDEVYREARALLERVGVG-EKADEYPRQLSGGQQQRVAIARALALRPAVILFDEPTSA 187 Query: 184 LGPHETQMVAELIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQLV 232 L P V E++ QL G + ++ H+V E+ D A M G +V Sbjct: 188 LDPELVGEVLEVLAQLARDGATLVIVTHEVGFAREVADTAVFMDGGVIV 236 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 261 Length adjustment: 25 Effective length of query: 235 Effective length of database: 236 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory