Align PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component (characterized)
to candidate WP_050655246.1 C1M55_RS19670 PTS glucose transporter subunit IIA
Query= SwissProt::P0A283 (169 letters) >NCBI__GCF_002893965.1:WP_050655246.1 Length = 152 Score = 108 bits (269), Expect = 5e-29 Identities = 59/145 (40%), Positives = 87/145 (60%), Gaps = 7/145 (4%) Query: 23 IVAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNK----MVAPVDGTIGKIFETNHAF 78 ++APL G +V + DVPD VFA+++VG G+AI+P + +VAP+ G I K+ HAF Sbjct: 4 VLAPLPGRVVALADVPDPVFAQQMVGSGVAIEPARGQGPLTVVAPISGKILKLHP--HAF 61 Query: 79 SIESDSGIELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDPVIEFDLPLLEEKAKSTLTP 138 I + + VH GIDTV+L+G+GF IA EG V GDP++ FD ++ S + P Sbjct: 62 VIFGEKATGVLVHIGIDTVKLEGDGFTLIAAEGDTVDAGDPIVSFDPAHIDTTGYSAICP 121 Query: 139 VVI-SNMDEIKELIKLSGSVTVGET 162 VV+ + + E + G VT G+T Sbjct: 122 VVVMDSKPDTVESPSVGGDVTTGDT 146 Lambda K H 0.315 0.139 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 108 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 169 Length of database: 152 Length adjustment: 17 Effective length of query: 152 Effective length of database: 135 Effective search space: 20520 Effective search space used: 20520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory