Align 2-oxopent-4-enoate hydratase (EC 4.2.1.80) (characterized)
to candidate WP_102999320.1 C1M55_RS04075 2-keto-4-pentenoate hydratase
Query= metacyc::MONOMER-14738 (279 letters) >NCBI__GCF_002893965.1:WP_102999320.1 Length = 261 Score = 208 bits (529), Expect = 1e-58 Identities = 111/249 (44%), Positives = 149/249 (59%) Query: 29 DELYQSLLDRQPVAPLTDREADITIEDAYQIQLRMIQRRLDAGERVVGKKIGVTSKVVMD 88 D L + DR P++PL DI + DAY+IQL I+RR+ G +VVG K+G++S + Sbjct: 12 DHLDSAERDRAPISPLIATYPDIDVVDAYEIQLINIRRRVAGGAKVVGHKVGLSSLAMQQ 71 Query: 89 MLKVNQPDFGHLLSGMVYNEGQPIPVSSMIAPKAEAEVAFILARDLEGPGVTAADVLRAT 148 M+ V++PD+GHLL+ M E +P+ S P+ E EVAFIL DL G G T DV+ AT Sbjct: 72 MMGVDEPDYGHLLAEMEEFENRPVDTSRFCFPRVEVEVAFILGADLPGAGCTEQDVIDAT 131 Query: 149 DCVMPCFEIVDSRIKDWKIKIQDTVADNASCGVLTLGGLRKSPRDLDLALAGMVLEKNGE 208 P E++DSRIKDWKI + DT+ADNAS LG R P D+D+ VL NGE Sbjct: 132 VAYAPSIELIDSRIKDWKIGLSDTIADNASSAGFILGKERVRPSDIDIKAIDAVLTCNGE 191 Query: 209 IISTSCGASVQGSPVNAVAWLANTLGRLGIGLKAGDIILSGSQSPLVPVVAGDSLYCSVG 268 I+ +V G+PV AVAWLA + G+ LKAGDI+L GS + + GD+ Sbjct: 192 RIAEGRSDAVLGNPVTAVAWLAQKVDTFGVWLKAGDIVLPGSCTRAIDAHPGDNFRAEFS 251 Query: 269 GLGGTSVRF 277 GLG S++F Sbjct: 252 GLGSVSLQF 260 Lambda K H 0.318 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 261 Length adjustment: 25 Effective length of query: 254 Effective length of database: 236 Effective search space: 59944 Effective search space used: 59944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory