Align 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial; 3-hydroxyisobutyryl-coenzyme A hydrolase; HIB-CoA hydrolase; HIBYL-CoA-H; EC 3.1.2.4 (characterized)
to candidate WP_050655249.1 C1M55_RS19620 enoyl-CoA hydratase/isomerase family protein
Query= SwissProt::Q5XIE6 (385 letters) >NCBI__GCF_002893965.1:WP_050655249.1 Length = 352 Score = 283 bits (723), Expect = 7e-81 Identities = 154/353 (43%), Positives = 215/353 (60%), Gaps = 12/353 (3%) Query: 32 TETAEVLLERRGCAGVITLNRPKLLNALSLNMIRQIYPQLKKWERDPDTFLIIIKGAGGK 91 ++ EVL+E+R G+ITLNRPK +NAL+ +M++ + L +W+ D D +++ GAG + Sbjct: 2 SDELEVLIEKRDGLGLITLNRPKAINALNHSMVKAMAKALAEWKYDDDVKAVVLTGAGER 61 Query: 92 AFCAGGDIKALSEAKKAGQTLSQDLFREEYILNNAIASCQKPYVALIDGITMGGGVGLSV 151 CAGGDI ++ K G+T S D +REEYILN+ IA+ KPYVA++DGI MGGGVG+S Sbjct: 62 GLCAGGDIVSIYHDAKDGKTGSLDFWREEYILNSEIANYPKPYVAIMDGIVMGGGVGVSA 121 Query: 152 HGQFRVATERSLFAMPETGIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVHRAGI 211 HG R+ TERS+ MPETGIG PDVGG Y L R G+LG +ALT RL D AG Sbjct: 122 HGDIRIVTERSMIGMPETGIGFIPDVGGTYLLSRAPGELGTHIALTTARLSAGDAIAAGF 181 Query: 212 ATHFVDSEKLHVLEEELLALKSPSAEDVAGVLESYHAKSKMGQDKSIIFEEHMDKINSCF 271 A HF+ SE +E + AL S S D S++ +S I++ + Sbjct: 182 ADHFIPSEN---IETFIAALASSSVADAVAQYAEPAPVSELSAQQS--------WIDAAY 230 Query: 272 SANTVEQILENLRQDGSPFAMEQIKVINKMSPTSLKITLRQLMEG-STKTLQEVLTMEYR 330 SA+ V I+E LR G P A + + I SP +L +TLR L +L+EVL E+R Sbjct: 231 SADDVSTIVERLRASGIPEAEKAAEQILGKSPIALSVTLRSLRHAKEAASLEEVLNEEFR 290 Query: 331 LTQACMEGHDFHEGVRAVLIDKDQTPKWKPADLKDVTDEDLNSYFKSLGSRDL 383 ++ A + HD EG+RA +++KD+ PKW PA L+DVT E +++YF LG +L Sbjct: 291 VSTAALASHDLVEGIRAQVVEKDRNPKWLPATLEDVTAESVDAYFAPLGDNEL 343 Lambda K H 0.320 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 352 Length adjustment: 30 Effective length of query: 355 Effective length of database: 322 Effective search space: 114310 Effective search space used: 114310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory