Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_020906733.1 C1M55_RS07930 ATP-binding cassette domain-containing protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_002893965.1:WP_020906733.1 Length = 234 Score = 167 bits (423), Expect = 2e-46 Identities = 95/231 (41%), Positives = 143/231 (61%), Gaps = 9/231 (3%) Query: 3 VLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEF 62 +L+++ ++V YG AVR+VS GEV +++G NGAGKT++ ++ G V P++G I+F Sbjct: 1 MLELDRVTVRYGSAVAVREVSLVAPAGEVTAIVGPNGAGKTSLAGSIYGSV-PATGTIKF 59 Query: 63 LGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFSR 122 G+EIQK+ A V G + VP+GR +F ++V ENL +GA L + E ++ F R Sbjct: 60 DGREIQKLSALDRVRSGFAYVPQGRQLFMRMSVRENLRVGADLLGLKAEA---VETAFER 116 Query: 123 FPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDI 182 FP L ER A LSGGEQQML +GRAL+ TPK+LLLDE GLAP + E+ ++ + Sbjct: 117 FPILRERSESYAGVLSGGEQQMLVLGRALLETPKVLLLDEMMTGLAPKIVAELRALVGGL 176 Query: 183 QKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAY 233 +G TV++ E ++ DRGYV++ G++V +E S+ + AY Sbjct: 177 AAEGVTVIVTEPALTALKSVVDRGYVMQRGELV-----RECDSAATLDNAY 222 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 234 Length adjustment: 23 Effective length of query: 213 Effective length of database: 211 Effective search space: 44943 Effective search space used: 44943 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory