Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_019748978.1 C1M55_RS18165 sugar ABC transporter permease
Query= uniprot:D8IPH8 (292 letters) >NCBI__GCF_002893965.1:WP_019748978.1 Length = 316 Score = 122 bits (306), Expect = 1e-32 Identities = 84/276 (30%), Positives = 148/276 (53%), Gaps = 7/276 (2%) Query: 16 PSLLVMLVLGLVPTVAAINLALKNRVLRYPDSDYV-WLRNLERLMSDRRFLNAIEVSAVW 74 P+L+ +V+ +P + + + ++ L P S + N + D +F + + Sbjct: 37 PALIFSIVVTQIPFLFTLYYSTQSWNLVRPGSRHFNGFDNYIEVFKDSQFREVAVNTVIM 96 Query: 75 EVVTVLGAVIVGIAIAVYLFENVHGKWRQAMCVLLITPVLLPRVSAAFIWKF-MYSPLTG 133 V TV+ +VI+G+A+A+ L G R + LLITP L+ V+ A +WK M+ P+ G Sbjct: 97 IVGTVIVSVILGLALALLLDRAFLG--RGIVRTLLITPFLITPVAGALLWKTTMFDPVFG 154 Query: 134 ILGWLLGLVGIHDTAFLSDPALALYAVALVDIWQWGLFFAVIVLKLLETLPPEPLEAARL 193 I+ ++L G+ ++S LA + L IWQW F +++L L+++P + LEAAR+ Sbjct: 155 IVNFVLQPFGVGQVDWVSKFPLAAVMINL--IWQWTPFMMLLILAGLQSMPRDILEAARV 212 Query: 194 DYARTWQVYAYIALPMLKGPLISLVFIKMVESLRSFDLIYVMTKGGPGVATETLDMYAYA 253 D A+ + ++ + LP L+ + + + + +FD +Y+MT GGPGVA+ L Y Y Sbjct: 213 DGAKPFAMFRELTLPHLRRFIELGAVLGAIYLVNTFDAVYMMTSGGPGVASSNLPFYIYQ 272 Query: 254 QGIGLSGKVSYASTMAVLMMIATTLIFTLIWKRVSK 289 + L V A+ M V+ +IAT ++ TL + + K Sbjct: 273 RAF-LGFDVGQAAAMGVVTVIATIIVSTLALRLIFK 307 Lambda K H 0.328 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 316 Length adjustment: 27 Effective length of query: 265 Effective length of database: 289 Effective search space: 76585 Effective search space used: 76585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory